Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HLR7

Protein Details
Accession C6HLR7    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
81-103VSRIPPSRAKRVRENGKLRPLNSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR006856  MATalpha_HMGbox  
Gene Ontology GO:0005634  C:nucleus  
GO:0008301  F:DNA binding, bending  
GO:0045895  P:positive regulation of mating-type specific transcription, DNA-templated  
Pfam View protein in Pfam  
PF04769  MATalpha_HMGbox  
PROSITE View protein in PROSITE  
PS51325  ALPHA_BOX  
Amino Acid Sequences MAGNDVSAVHRAFNKLFTTLTPDQVQNFQHFLHEATASTTNPTGNAAGIPSMGNGPTNIQKTNSLTDMATPILAPAASNAVSRIPPSRAKRVRENGKLRPLNSFIAFRSFYSTAFPDLSQKIKSGLLRLLWTSDPFKAKWAILAKAYSIIRDSHAGQVNLESFLELNGPLIGIVAPSDYLRVMGLKLAESMDKQFSVIKTNHHVGPTQGDLTTNLSVDDIVTHCYQTGYVVGVLTPRNNNHGVGVAMAVTAQPNLAHYPQSGNLCQQNTASSPRPRTAHNGSPKLATANPNLVIDTETGSAESLAISSSSIRSEPNSDAALNVNSIMHLQGNFECVNPTLESPYTAEDFDQELRTAMNEFPIAPDDNGYFTLFNPELRNPVYIYNPYRVQSDFDPYDIGQYIDM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.25
4 0.24
5 0.3
6 0.29
7 0.33
8 0.32
9 0.32
10 0.32
11 0.37
12 0.39
13 0.34
14 0.33
15 0.28
16 0.27
17 0.26
18 0.25
19 0.22
20 0.2
21 0.16
22 0.18
23 0.2
24 0.19
25 0.2
26 0.19
27 0.17
28 0.16
29 0.18
30 0.14
31 0.12
32 0.12
33 0.11
34 0.1
35 0.1
36 0.1
37 0.09
38 0.09
39 0.09
40 0.09
41 0.09
42 0.11
43 0.17
44 0.2
45 0.21
46 0.21
47 0.25
48 0.28
49 0.32
50 0.3
51 0.26
52 0.23
53 0.23
54 0.23
55 0.19
56 0.16
57 0.12
58 0.1
59 0.09
60 0.09
61 0.07
62 0.06
63 0.08
64 0.08
65 0.09
66 0.09
67 0.11
68 0.11
69 0.13
70 0.16
71 0.18
72 0.26
73 0.31
74 0.42
75 0.48
76 0.53
77 0.62
78 0.69
79 0.75
80 0.77
81 0.81
82 0.79
83 0.82
84 0.81
85 0.71
86 0.67
87 0.6
88 0.53
89 0.47
90 0.4
91 0.3
92 0.3
93 0.3
94 0.25
95 0.28
96 0.24
97 0.22
98 0.23
99 0.23
100 0.19
101 0.2
102 0.2
103 0.18
104 0.2
105 0.23
106 0.21
107 0.2
108 0.2
109 0.22
110 0.23
111 0.21
112 0.22
113 0.21
114 0.22
115 0.21
116 0.22
117 0.19
118 0.2
119 0.19
120 0.2
121 0.21
122 0.19
123 0.21
124 0.21
125 0.21
126 0.24
127 0.26
128 0.24
129 0.24
130 0.24
131 0.22
132 0.24
133 0.24
134 0.19
135 0.17
136 0.15
137 0.14
138 0.15
139 0.17
140 0.18
141 0.22
142 0.22
143 0.2
144 0.21
145 0.21
146 0.19
147 0.18
148 0.11
149 0.07
150 0.07
151 0.07
152 0.05
153 0.05
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.05
170 0.05
171 0.06
172 0.06
173 0.06
174 0.07
175 0.07
176 0.07
177 0.09
178 0.09
179 0.08
180 0.09
181 0.1
182 0.1
183 0.15
184 0.15
185 0.16
186 0.19
187 0.22
188 0.24
189 0.22
190 0.22
191 0.18
192 0.19
193 0.18
194 0.15
195 0.12
196 0.1
197 0.1
198 0.13
199 0.12
200 0.1
201 0.09
202 0.08
203 0.07
204 0.07
205 0.07
206 0.05
207 0.07
208 0.07
209 0.07
210 0.07
211 0.07
212 0.07
213 0.07
214 0.07
215 0.06
216 0.06
217 0.06
218 0.05
219 0.08
220 0.08
221 0.1
222 0.11
223 0.11
224 0.15
225 0.16
226 0.16
227 0.14
228 0.15
229 0.13
230 0.11
231 0.11
232 0.07
233 0.06
234 0.05
235 0.05
236 0.04
237 0.04
238 0.03
239 0.03
240 0.04
241 0.06
242 0.07
243 0.08
244 0.08
245 0.11
246 0.14
247 0.18
248 0.18
249 0.19
250 0.23
251 0.23
252 0.23
253 0.21
254 0.2
255 0.19
256 0.23
257 0.27
258 0.29
259 0.32
260 0.35
261 0.37
262 0.37
263 0.42
264 0.44
265 0.46
266 0.5
267 0.53
268 0.49
269 0.49
270 0.48
271 0.43
272 0.38
273 0.33
274 0.26
275 0.24
276 0.25
277 0.23
278 0.23
279 0.2
280 0.19
281 0.15
282 0.14
283 0.11
284 0.09
285 0.09
286 0.09
287 0.08
288 0.07
289 0.07
290 0.05
291 0.04
292 0.04
293 0.04
294 0.05
295 0.06
296 0.07
297 0.08
298 0.08
299 0.1
300 0.14
301 0.15
302 0.18
303 0.19
304 0.18
305 0.18
306 0.2
307 0.19
308 0.15
309 0.14
310 0.11
311 0.09
312 0.09
313 0.09
314 0.08
315 0.07
316 0.09
317 0.09
318 0.13
319 0.13
320 0.13
321 0.14
322 0.13
323 0.16
324 0.15
325 0.15
326 0.15
327 0.15
328 0.17
329 0.17
330 0.19
331 0.18
332 0.17
333 0.16
334 0.14
335 0.16
336 0.18
337 0.18
338 0.16
339 0.14
340 0.14
341 0.15
342 0.15
343 0.13
344 0.13
345 0.12
346 0.12
347 0.13
348 0.16
349 0.18
350 0.16
351 0.18
352 0.16
353 0.17
354 0.18
355 0.18
356 0.15
357 0.13
358 0.2
359 0.19
360 0.21
361 0.23
362 0.23
363 0.27
364 0.28
365 0.3
366 0.24
367 0.27
368 0.3
369 0.34
370 0.36
371 0.38
372 0.41
373 0.4
374 0.42
375 0.39
376 0.38
377 0.33
378 0.38
379 0.33
380 0.3
381 0.32
382 0.29
383 0.32
384 0.28