Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D9P7L0

Protein Details
Accession A0A0D9P7L0   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-53APAAGAKKQKKKWSKGKVKDKAQHAVHydrophilic
NLS Segment(s)
PositionSequence
32-48GAKKQKKKWSKGKVKDK
Subcellular Location(s) mito 10, cyto_nucl 9, nucl 8.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MVRQARSPPPVPLEALCFYHEPEREVMAPAAGAKKQKKKWSKGKVKDKAQHAVLLDKTTSEKLYKDVQSYRLVTVATLVDRMKVNGSLARKCLADLEEKGLIKPVVTHSKMKIYTRAVGGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.28
4 0.23
5 0.23
6 0.26
7 0.26
8 0.23
9 0.22
10 0.23
11 0.21
12 0.23
13 0.21
14 0.15
15 0.14
16 0.14
17 0.15
18 0.14
19 0.19
20 0.24
21 0.33
22 0.4
23 0.5
24 0.58
25 0.65
26 0.74
27 0.79
28 0.83
29 0.85
30 0.9
31 0.9
32 0.9
33 0.87
34 0.82
35 0.77
36 0.67
37 0.59
38 0.49
39 0.43
40 0.33
41 0.28
42 0.22
43 0.15
44 0.15
45 0.13
46 0.13
47 0.1
48 0.09
49 0.11
50 0.17
51 0.18
52 0.21
53 0.23
54 0.25
55 0.29
56 0.3
57 0.28
58 0.24
59 0.22
60 0.18
61 0.16
62 0.14
63 0.09
64 0.1
65 0.09
66 0.1
67 0.1
68 0.11
69 0.11
70 0.11
71 0.12
72 0.14
73 0.18
74 0.19
75 0.21
76 0.22
77 0.21
78 0.2
79 0.22
80 0.19
81 0.21
82 0.19
83 0.23
84 0.26
85 0.26
86 0.26
87 0.27
88 0.25
89 0.2
90 0.21
91 0.23
92 0.27
93 0.3
94 0.35
95 0.34
96 0.44
97 0.49
98 0.5
99 0.51
100 0.46
101 0.48