Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D9NXA4

Protein Details
Accession A0A0D9NXA4    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
343-363AAPPATRKPSRAKAPSKAAITHydrophilic
NLS Segment(s)
PositionSequence
331-359DARTSKGKPRAGAAPPATRKPSRAKAPSK
Subcellular Location(s) cyto 8.5, cyto_nucl 8.5, nucl 7.5, pero 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006886  RNA_pol_III_Rpc5  
Gene Ontology GO:0005634  C:nucleus  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF04801  RPC5  
Amino Acid Sequences MDIDNDVEDDDPITASYPVFLNPALPLGRRLLVLQQPNRTDDTPRPPPTELRLKAHSGMVEIDLPLDNTTAYDREKGLKWGRILQSSMASKNGGSHGLAGGFGFGAVQQRGKKKGETDDDEYMDWNEAVRQDKVLRTQTLGGQYPDTDEVQYMVGVFQGKNLHLTPVSSLVHLRPQLHHLDAATQQERNASASASKEAAGSSSTAARAIHMTIKNTADGDAVTTETMADRLRFVQTENWRKMRYTDENDEAAWEVYNESLFLQLRNDTNKSEDEGETKEGEGAKKDMEELVPRFGAKWNDKQMLEAVSGIEKPDPEPEIKPEPKGKQDAEDARTSKGKPRAGAAPPATRKPSRAKAPSKAAITID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.09
4 0.09
5 0.1
6 0.11
7 0.11
8 0.11
9 0.1
10 0.15
11 0.16
12 0.16
13 0.17
14 0.19
15 0.21
16 0.2
17 0.21
18 0.24
19 0.29
20 0.37
21 0.41
22 0.46
23 0.47
24 0.5
25 0.53
26 0.47
27 0.45
28 0.44
29 0.47
30 0.49
31 0.52
32 0.54
33 0.53
34 0.55
35 0.58
36 0.61
37 0.57
38 0.53
39 0.52
40 0.51
41 0.51
42 0.49
43 0.42
44 0.32
45 0.28
46 0.23
47 0.19
48 0.15
49 0.14
50 0.12
51 0.12
52 0.1
53 0.09
54 0.08
55 0.07
56 0.09
57 0.1
58 0.11
59 0.13
60 0.14
61 0.18
62 0.2
63 0.28
64 0.33
65 0.36
66 0.37
67 0.43
68 0.46
69 0.46
70 0.45
71 0.39
72 0.39
73 0.37
74 0.36
75 0.29
76 0.25
77 0.22
78 0.23
79 0.22
80 0.17
81 0.13
82 0.13
83 0.12
84 0.11
85 0.11
86 0.09
87 0.07
88 0.06
89 0.05
90 0.04
91 0.04
92 0.06
93 0.07
94 0.11
95 0.15
96 0.2
97 0.26
98 0.28
99 0.3
100 0.32
101 0.4
102 0.45
103 0.47
104 0.49
105 0.49
106 0.48
107 0.45
108 0.42
109 0.34
110 0.26
111 0.19
112 0.13
113 0.09
114 0.1
115 0.12
116 0.12
117 0.13
118 0.15
119 0.17
120 0.23
121 0.26
122 0.25
123 0.24
124 0.26
125 0.27
126 0.29
127 0.29
128 0.24
129 0.2
130 0.19
131 0.19
132 0.18
133 0.16
134 0.11
135 0.09
136 0.09
137 0.08
138 0.08
139 0.07
140 0.05
141 0.06
142 0.07
143 0.06
144 0.08
145 0.09
146 0.1
147 0.12
148 0.12
149 0.12
150 0.11
151 0.12
152 0.1
153 0.13
154 0.13
155 0.11
156 0.12
157 0.11
158 0.15
159 0.17
160 0.17
161 0.14
162 0.17
163 0.19
164 0.19
165 0.19
166 0.15
167 0.15
168 0.16
169 0.19
170 0.17
171 0.15
172 0.14
173 0.15
174 0.15
175 0.14
176 0.12
177 0.08
178 0.08
179 0.09
180 0.1
181 0.1
182 0.1
183 0.09
184 0.08
185 0.09
186 0.08
187 0.07
188 0.06
189 0.07
190 0.07
191 0.07
192 0.07
193 0.07
194 0.08
195 0.08
196 0.14
197 0.14
198 0.16
199 0.18
200 0.18
201 0.18
202 0.18
203 0.18
204 0.12
205 0.1
206 0.09
207 0.07
208 0.07
209 0.06
210 0.06
211 0.05
212 0.05
213 0.06
214 0.06
215 0.06
216 0.06
217 0.08
218 0.09
219 0.09
220 0.11
221 0.17
222 0.26
223 0.36
224 0.42
225 0.46
226 0.46
227 0.46
228 0.47
229 0.48
230 0.47
231 0.45
232 0.45
233 0.44
234 0.44
235 0.43
236 0.41
237 0.34
238 0.26
239 0.18
240 0.12
241 0.07
242 0.06
243 0.06
244 0.06
245 0.05
246 0.08
247 0.08
248 0.08
249 0.09
250 0.12
251 0.15
252 0.19
253 0.21
254 0.2
255 0.22
256 0.23
257 0.24
258 0.25
259 0.23
260 0.21
261 0.22
262 0.24
263 0.22
264 0.21
265 0.2
266 0.19
267 0.19
268 0.18
269 0.17
270 0.15
271 0.15
272 0.15
273 0.15
274 0.14
275 0.19
276 0.19
277 0.22
278 0.22
279 0.21
280 0.22
281 0.25
282 0.31
283 0.3
284 0.37
285 0.42
286 0.47
287 0.47
288 0.48
289 0.46
290 0.4
291 0.36
292 0.27
293 0.2
294 0.15
295 0.16
296 0.15
297 0.13
298 0.11
299 0.11
300 0.15
301 0.16
302 0.17
303 0.2
304 0.25
305 0.34
306 0.37
307 0.42
308 0.47
309 0.51
310 0.56
311 0.61
312 0.57
313 0.52
314 0.58
315 0.6
316 0.56
317 0.59
318 0.52
319 0.49
320 0.52
321 0.49
322 0.48
323 0.47
324 0.48
325 0.42
326 0.45
327 0.5
328 0.5
329 0.58
330 0.55
331 0.58
332 0.59
333 0.64
334 0.66
335 0.59
336 0.6
337 0.6
338 0.63
339 0.63
340 0.68
341 0.7
342 0.73
343 0.8
344 0.83
345 0.77