Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D9NSB6

Protein Details
Accession A0A0D9NSB6    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
10-38RTLCRPRPPATSPRSRRPWRQTASNAAFSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007400  PrpF_protein  
Gene Ontology GO:0016853  F:isomerase activity  
Pfam View protein in Pfam  
PF04303  PrpF  
Amino Acid Sequences MPPSDMRALRTLCRPRPPATSPRSRRPWRQTASNAAFSHRSFPAWFVRGGTSNGLVIRRQDLPPEDEWPSVLPSAMGSPDPDFGRQLNGMGSGQSSTSKVVVLGAPSRAGADVDYTFVQVGIRDGALDKAGNCGNMSAIVGPAAWDQGLVGPDTVSAPVETDRRGRRWATVRVFNTNTSKLVVSRFRVSGSPARYTPEGEYVMDGVPGAGSVVTLSFVDPAGAKTGRALPTGAPVDTLRLPGGSRVRASLVDVGNPGVFVSTHGLGLDRVAASALTPAAIEADAALKARLEQIRRAGAAEMGLDPDVESVPKIVLLFPGGDTPDGVDIRCVAMSMGQAHKAVPLTLALCLGASARIPGTLAADLVAARLGGMRDDAVTIAHPSGKLDVGTEVEDGKIFEKMGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.61
3 0.66
4 0.68
5 0.69
6 0.68
7 0.72
8 0.71
9 0.76
10 0.82
11 0.83
12 0.86
13 0.86
14 0.87
15 0.84
16 0.85
17 0.82
18 0.82
19 0.81
20 0.79
21 0.69
22 0.62
23 0.59
24 0.49
25 0.47
26 0.37
27 0.32
28 0.24
29 0.27
30 0.31
31 0.29
32 0.29
33 0.27
34 0.29
35 0.3
36 0.31
37 0.3
38 0.22
39 0.22
40 0.23
41 0.23
42 0.21
43 0.2
44 0.21
45 0.23
46 0.22
47 0.26
48 0.27
49 0.3
50 0.31
51 0.33
52 0.33
53 0.29
54 0.29
55 0.25
56 0.23
57 0.19
58 0.17
59 0.12
60 0.09
61 0.11
62 0.11
63 0.1
64 0.09
65 0.1
66 0.14
67 0.15
68 0.16
69 0.16
70 0.15
71 0.18
72 0.17
73 0.17
74 0.14
75 0.15
76 0.14
77 0.13
78 0.13
79 0.1
80 0.1
81 0.1
82 0.1
83 0.09
84 0.09
85 0.09
86 0.09
87 0.1
88 0.1
89 0.11
90 0.13
91 0.13
92 0.13
93 0.13
94 0.13
95 0.12
96 0.11
97 0.08
98 0.08
99 0.08
100 0.09
101 0.1
102 0.1
103 0.09
104 0.09
105 0.09
106 0.07
107 0.07
108 0.06
109 0.06
110 0.06
111 0.06
112 0.07
113 0.08
114 0.08
115 0.07
116 0.1
117 0.1
118 0.11
119 0.1
120 0.1
121 0.09
122 0.09
123 0.09
124 0.06
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.04
132 0.04
133 0.04
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.06
140 0.07
141 0.07
142 0.05
143 0.05
144 0.05
145 0.07
146 0.08
147 0.1
148 0.16
149 0.2
150 0.22
151 0.26
152 0.27
153 0.32
154 0.38
155 0.46
156 0.45
157 0.5
158 0.49
159 0.52
160 0.53
161 0.49
162 0.46
163 0.39
164 0.33
165 0.25
166 0.24
167 0.18
168 0.21
169 0.21
170 0.2
171 0.21
172 0.21
173 0.21
174 0.21
175 0.23
176 0.25
177 0.24
178 0.25
179 0.22
180 0.24
181 0.23
182 0.24
183 0.22
184 0.2
185 0.18
186 0.15
187 0.14
188 0.13
189 0.12
190 0.11
191 0.09
192 0.05
193 0.04
194 0.04
195 0.03
196 0.02
197 0.02
198 0.02
199 0.02
200 0.03
201 0.03
202 0.03
203 0.04
204 0.04
205 0.04
206 0.04
207 0.05
208 0.08
209 0.08
210 0.08
211 0.09
212 0.14
213 0.15
214 0.15
215 0.16
216 0.12
217 0.17
218 0.19
219 0.18
220 0.14
221 0.12
222 0.14
223 0.14
224 0.15
225 0.1
226 0.09
227 0.09
228 0.12
229 0.16
230 0.15
231 0.15
232 0.15
233 0.17
234 0.16
235 0.18
236 0.19
237 0.16
238 0.15
239 0.15
240 0.15
241 0.14
242 0.13
243 0.11
244 0.06
245 0.06
246 0.05
247 0.08
248 0.07
249 0.08
250 0.08
251 0.08
252 0.08
253 0.08
254 0.09
255 0.06
256 0.06
257 0.06
258 0.05
259 0.05
260 0.06
261 0.06
262 0.04
263 0.04
264 0.04
265 0.04
266 0.04
267 0.04
268 0.04
269 0.05
270 0.05
271 0.06
272 0.06
273 0.05
274 0.06
275 0.11
276 0.15
277 0.16
278 0.2
279 0.25
280 0.29
281 0.29
282 0.3
283 0.26
284 0.22
285 0.21
286 0.18
287 0.13
288 0.1
289 0.09
290 0.08
291 0.07
292 0.07
293 0.07
294 0.06
295 0.06
296 0.05
297 0.05
298 0.06
299 0.07
300 0.07
301 0.07
302 0.08
303 0.09
304 0.09
305 0.11
306 0.11
307 0.1
308 0.1
309 0.1
310 0.13
311 0.13
312 0.12
313 0.1
314 0.1
315 0.11
316 0.11
317 0.1
318 0.07
319 0.08
320 0.1
321 0.13
322 0.15
323 0.16
324 0.17
325 0.17
326 0.19
327 0.18
328 0.17
329 0.13
330 0.13
331 0.11
332 0.12
333 0.12
334 0.09
335 0.08
336 0.08
337 0.08
338 0.07
339 0.06
340 0.07
341 0.07
342 0.07
343 0.08
344 0.08
345 0.1
346 0.1
347 0.09
348 0.08
349 0.09
350 0.08
351 0.08
352 0.08
353 0.05
354 0.05
355 0.07
356 0.06
357 0.06
358 0.07
359 0.08
360 0.08
361 0.09
362 0.09
363 0.08
364 0.09
365 0.11
366 0.11
367 0.13
368 0.13
369 0.13
370 0.15
371 0.16
372 0.15
373 0.14
374 0.15
375 0.15
376 0.16
377 0.16
378 0.15
379 0.14
380 0.14
381 0.14
382 0.13
383 0.12