Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D9NUV5

Protein Details
Accession A0A0D9NUV5   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
381-403KSEERQFEKEKAKKAKRDAELKGBasic
406-432AKAQKKYLEKEKEKELRRSQKKMTMRGBasic
NLS Segment(s)
PositionSequence
385-431RQFEKEKAKKAKRDAELKGLDAKAQKKYLEKEKEKELRRSQKKMTMR
Subcellular Location(s) cyto_nucl 12, nucl 11.5, cyto 9.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012879  CCDC47  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
GO:0005509  F:calcium ion binding  
GO:0032469  P:endoplasmic reticulum calcium ion homeostasis  
Pfam View protein in Pfam  
PF07946  CCDC47  
Amino Acid Sequences MADFLKNVFGGGKASEPAVKLKADPDFADFAGAPDPVAEPVPAATIGGPGAAATSRPYTKWYNVHERHSLSEFKAEGVILAISALIFLFHIIGARANRSKARSWIRANASILRKEFALVGFGAVPTMDNEHIKPDSLLKEKSLFEFATYASGRQNTAFVDVKLTLTKKFNPIMNLAETAASFFSDVFTAPGDVMEAFLYPFDGKESLTIPSLPGSEEARAKDAKSNYDGFVWALVNKESMKRLREDRYDVTLTATKESPKLPNWLTVMSESAEVTDTLLTQDLIDAVVAAGDKFEYLIVSDQPVDKPVKLDDAAPRKRIFLKYRLPSDNNYDNLLPIFSHFLRLPDFLVQNGRFRPEVLKKVRATREAMISQIKKAAEEEKSEERQFEKEKAKKAKRDAELKGLDAKAQKKYLEKEKEKELRRSQKKMTMRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.17
3 0.17
4 0.21
5 0.22
6 0.22
7 0.21
8 0.25
9 0.28
10 0.29
11 0.29
12 0.28
13 0.28
14 0.27
15 0.29
16 0.24
17 0.2
18 0.19
19 0.17
20 0.13
21 0.11
22 0.11
23 0.1
24 0.1
25 0.09
26 0.08
27 0.08
28 0.1
29 0.09
30 0.08
31 0.08
32 0.07
33 0.07
34 0.07
35 0.06
36 0.05
37 0.06
38 0.05
39 0.06
40 0.07
41 0.12
42 0.14
43 0.15
44 0.19
45 0.24
46 0.3
47 0.38
48 0.44
49 0.51
50 0.55
51 0.61
52 0.64
53 0.62
54 0.59
55 0.55
56 0.51
57 0.42
58 0.41
59 0.35
60 0.28
61 0.27
62 0.22
63 0.18
64 0.15
65 0.13
66 0.07
67 0.06
68 0.05
69 0.04
70 0.04
71 0.04
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.04
78 0.05
79 0.08
80 0.1
81 0.15
82 0.18
83 0.21
84 0.25
85 0.28
86 0.31
87 0.37
88 0.45
89 0.48
90 0.51
91 0.57
92 0.59
93 0.62
94 0.61
95 0.6
96 0.57
97 0.53
98 0.49
99 0.4
100 0.34
101 0.28
102 0.27
103 0.19
104 0.15
105 0.1
106 0.1
107 0.09
108 0.09
109 0.08
110 0.07
111 0.07
112 0.05
113 0.07
114 0.08
115 0.09
116 0.09
117 0.13
118 0.13
119 0.14
120 0.14
121 0.16
122 0.21
123 0.24
124 0.25
125 0.24
126 0.28
127 0.28
128 0.29
129 0.28
130 0.23
131 0.19
132 0.18
133 0.17
134 0.18
135 0.17
136 0.16
137 0.15
138 0.16
139 0.15
140 0.15
141 0.16
142 0.1
143 0.15
144 0.16
145 0.14
146 0.15
147 0.15
148 0.16
149 0.18
150 0.18
151 0.17
152 0.18
153 0.21
154 0.23
155 0.26
156 0.28
157 0.28
158 0.29
159 0.29
160 0.28
161 0.26
162 0.21
163 0.18
164 0.15
165 0.13
166 0.11
167 0.08
168 0.06
169 0.05
170 0.05
171 0.04
172 0.05
173 0.05
174 0.05
175 0.05
176 0.05
177 0.05
178 0.05
179 0.04
180 0.05
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.05
190 0.05
191 0.06
192 0.07
193 0.08
194 0.08
195 0.08
196 0.08
197 0.08
198 0.09
199 0.08
200 0.08
201 0.08
202 0.1
203 0.12
204 0.12
205 0.14
206 0.14
207 0.14
208 0.18
209 0.18
210 0.19
211 0.2
212 0.21
213 0.2
214 0.2
215 0.2
216 0.15
217 0.15
218 0.12
219 0.1
220 0.09
221 0.08
222 0.09
223 0.09
224 0.1
225 0.13
226 0.16
227 0.18
228 0.2
229 0.26
230 0.31
231 0.35
232 0.39
233 0.39
234 0.41
235 0.41
236 0.37
237 0.35
238 0.32
239 0.28
240 0.24
241 0.22
242 0.17
243 0.18
244 0.2
245 0.21
246 0.19
247 0.24
248 0.23
249 0.27
250 0.28
251 0.27
252 0.26
253 0.22
254 0.21
255 0.16
256 0.16
257 0.1
258 0.09
259 0.09
260 0.07
261 0.07
262 0.06
263 0.05
264 0.05
265 0.06
266 0.05
267 0.05
268 0.05
269 0.04
270 0.04
271 0.04
272 0.04
273 0.03
274 0.03
275 0.04
276 0.03
277 0.03
278 0.03
279 0.03
280 0.03
281 0.03
282 0.03
283 0.04
284 0.06
285 0.06
286 0.07
287 0.09
288 0.1
289 0.11
290 0.14
291 0.15
292 0.14
293 0.15
294 0.15
295 0.18
296 0.17
297 0.21
298 0.26
299 0.34
300 0.4
301 0.43
302 0.43
303 0.42
304 0.47
305 0.51
306 0.49
307 0.48
308 0.52
309 0.56
310 0.64
311 0.68
312 0.65
313 0.61
314 0.63
315 0.61
316 0.53
317 0.48
318 0.39
319 0.32
320 0.29
321 0.26
322 0.18
323 0.12
324 0.15
325 0.12
326 0.15
327 0.15
328 0.17
329 0.19
330 0.2
331 0.2
332 0.2
333 0.21
334 0.19
335 0.27
336 0.27
337 0.3
338 0.31
339 0.32
340 0.27
341 0.28
342 0.35
343 0.35
344 0.44
345 0.45
346 0.52
347 0.54
348 0.63
349 0.69
350 0.65
351 0.62
352 0.56
353 0.57
354 0.49
355 0.49
356 0.49
357 0.43
358 0.4
359 0.4
360 0.35
361 0.28
362 0.29
363 0.31
364 0.26
365 0.29
366 0.33
367 0.37
368 0.43
369 0.44
370 0.44
371 0.4
372 0.43
373 0.43
374 0.45
375 0.47
376 0.48
377 0.56
378 0.65
379 0.73
380 0.75
381 0.81
382 0.83
383 0.81
384 0.84
385 0.8
386 0.79
387 0.73
388 0.67
389 0.64
390 0.55
391 0.5
392 0.47
393 0.46
394 0.43
395 0.43
396 0.45
397 0.45
398 0.52
399 0.59
400 0.64
401 0.67
402 0.66
403 0.72
404 0.78
405 0.79
406 0.81
407 0.82
408 0.82
409 0.83
410 0.86
411 0.84
412 0.84