Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D9P0H0

Protein Details
Accession A0A0D9P0H0    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
55-81LGGYSERSRSRRRKRAWKKLMWVKQSFHydrophilic
NLS Segment(s)
PositionSequence
61-73RSRSRRRKRAWKK
Subcellular Location(s) plas 7, cyto 6, nucl 5, extr 3, mito_nucl 3, pero 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009450  Plno_GlcNAc_GPI2  
Gene Ontology GO:0016020  C:membrane  
GO:0006506  P:GPI anchor biosynthetic process  
Pfam View protein in Pfam  
PF06432  GPI2  
Amino Acid Sequences MPSPTDDETPFPALSHAATFSVFGRSHLSPQDAHLSPPRRARDFDGDGTSEMRRLGGYSERSRSRRRKRAWKKLMWVKQSFPDNYTDQATFLENLQRNPRLKPYDFWPLVADSTVILQHVCSVTIFIVCFVGIYHERVSPVSVVSWSSFATFVGWILWERWVSEEEDKEDEANAAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.14
4 0.11
5 0.11
6 0.11
7 0.12
8 0.16
9 0.15
10 0.15
11 0.19
12 0.19
13 0.22
14 0.25
15 0.26
16 0.21
17 0.24
18 0.31
19 0.26
20 0.28
21 0.33
22 0.34
23 0.37
24 0.44
25 0.48
26 0.43
27 0.45
28 0.48
29 0.49
30 0.5
31 0.49
32 0.44
33 0.4
34 0.37
35 0.37
36 0.31
37 0.22
38 0.17
39 0.13
40 0.09
41 0.08
42 0.1
43 0.13
44 0.2
45 0.23
46 0.3
47 0.37
48 0.42
49 0.51
50 0.6
51 0.65
52 0.69
53 0.73
54 0.78
55 0.83
56 0.9
57 0.91
58 0.89
59 0.88
60 0.89
61 0.88
62 0.84
63 0.76
64 0.67
65 0.62
66 0.59
67 0.49
68 0.4
69 0.35
70 0.28
71 0.26
72 0.26
73 0.21
74 0.15
75 0.15
76 0.14
77 0.11
78 0.1
79 0.14
80 0.14
81 0.15
82 0.19
83 0.24
84 0.25
85 0.26
86 0.32
87 0.32
88 0.32
89 0.33
90 0.33
91 0.39
92 0.38
93 0.37
94 0.32
95 0.27
96 0.25
97 0.23
98 0.19
99 0.08
100 0.08
101 0.08
102 0.06
103 0.05
104 0.05
105 0.06
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.07
112 0.07
113 0.06
114 0.06
115 0.05
116 0.06
117 0.05
118 0.09
119 0.09
120 0.11
121 0.13
122 0.14
123 0.15
124 0.15
125 0.16
126 0.13
127 0.12
128 0.11
129 0.1
130 0.11
131 0.11
132 0.12
133 0.11
134 0.11
135 0.11
136 0.1
137 0.1
138 0.09
139 0.08
140 0.08
141 0.08
142 0.08
143 0.09
144 0.12
145 0.11
146 0.12
147 0.13
148 0.14
149 0.17
150 0.22
151 0.25
152 0.25
153 0.28
154 0.28
155 0.27
156 0.26
157 0.23
158 0.18