Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6H634

Protein Details
Accession C6H634    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
178-198GSTKRFPQTKKQEAKSLRSARHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MAKAKAQKRPGKTGQSHLRARIAFLYKASTYLQAASLPKPSTDKKPNHAGAHGSHALLQEHDEEPTSQPLFSSKVASDSKNSTTDNAFFAPNHLQEQQPTHHVPVSKLSRNLASQMRGVSLKSQLRLPHDIKRSICKVCDSLLIPNATCVETVENASRGGSKKKPWADVRVVRCNSCGSTKRFPQTKKQEAKSLRSARSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.78
3 0.77
4 0.72
5 0.69
6 0.59
7 0.55
8 0.52
9 0.46
10 0.38
11 0.33
12 0.34
13 0.27
14 0.29
15 0.28
16 0.22
17 0.19
18 0.18
19 0.18
20 0.17
21 0.19
22 0.19
23 0.23
24 0.22
25 0.22
26 0.26
27 0.29
28 0.34
29 0.42
30 0.47
31 0.48
32 0.57
33 0.63
34 0.61
35 0.6
36 0.54
37 0.46
38 0.47
39 0.42
40 0.32
41 0.26
42 0.24
43 0.22
44 0.18
45 0.17
46 0.13
47 0.12
48 0.12
49 0.11
50 0.1
51 0.12
52 0.15
53 0.15
54 0.12
55 0.12
56 0.13
57 0.15
58 0.15
59 0.16
60 0.12
61 0.18
62 0.2
63 0.21
64 0.22
65 0.23
66 0.25
67 0.26
68 0.26
69 0.21
70 0.21
71 0.21
72 0.2
73 0.18
74 0.16
75 0.12
76 0.14
77 0.15
78 0.14
79 0.15
80 0.14
81 0.13
82 0.14
83 0.17
84 0.16
85 0.18
86 0.18
87 0.17
88 0.18
89 0.18
90 0.18
91 0.23
92 0.28
93 0.27
94 0.27
95 0.27
96 0.28
97 0.27
98 0.31
99 0.26
100 0.22
101 0.19
102 0.19
103 0.19
104 0.17
105 0.17
106 0.15
107 0.18
108 0.19
109 0.18
110 0.21
111 0.23
112 0.27
113 0.33
114 0.35
115 0.36
116 0.39
117 0.44
118 0.43
119 0.47
120 0.48
121 0.44
122 0.42
123 0.37
124 0.33
125 0.29
126 0.31
127 0.26
128 0.25
129 0.26
130 0.26
131 0.23
132 0.22
133 0.22
134 0.18
135 0.16
136 0.13
137 0.1
138 0.1
139 0.12
140 0.14
141 0.13
142 0.13
143 0.14
144 0.16
145 0.17
146 0.23
147 0.26
148 0.3
149 0.38
150 0.44
151 0.52
152 0.55
153 0.61
154 0.65
155 0.68
156 0.71
157 0.72
158 0.7
159 0.62
160 0.57
161 0.52
162 0.44
163 0.44
164 0.42
165 0.39
166 0.45
167 0.52
168 0.6
169 0.66
170 0.68
171 0.71
172 0.75
173 0.78
174 0.8
175 0.78
176 0.78
177 0.78
178 0.81
179 0.81
180 0.79