Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D9P059

Protein Details
Accession A0A0D9P059    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
244-269VKQLHLQHPAKQRKKGAPKGEQAIKHHydrophilic
NLS Segment(s)
PositionSequence
254-262KQRKKGAPK
Subcellular Location(s) cyto 12.5, cyto_nucl 9, mito 7, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MDYASNVWSHACGEKETLWLNQAQAIGAQAVTGAFRSVATAVAEAEAGIAPVLERHAKTAAKNWVNLRTLPREHPLARLNMRICRRFTSPMQKVAEFYKEVAGQRLEVIQEFAMEPWERRIPVLCYADRDKATQLARKARGVVVSTSSSERGGIVGMGGCVEYVTAKGKRDVLVRDSATLGPREDLNPYVAELEAIARGFWYLPATLRHKNVTVVTSSKSAALVIAQPRQQSGQHTIGEVYGQVKQLHLQHPAKQRKKGAPKGEQAIKHGLREQGCCSAGSSSGREGYRQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.25
4 0.25
5 0.23
6 0.23
7 0.22
8 0.22
9 0.21
10 0.17
11 0.14
12 0.14
13 0.12
14 0.1
15 0.09
16 0.06
17 0.06
18 0.06
19 0.06
20 0.05
21 0.05
22 0.05
23 0.06
24 0.06
25 0.08
26 0.09
27 0.09
28 0.09
29 0.09
30 0.09
31 0.07
32 0.08
33 0.06
34 0.05
35 0.04
36 0.04
37 0.03
38 0.04
39 0.06
40 0.09
41 0.09
42 0.12
43 0.17
44 0.19
45 0.21
46 0.28
47 0.36
48 0.37
49 0.41
50 0.43
51 0.46
52 0.47
53 0.48
54 0.46
55 0.43
56 0.44
57 0.43
58 0.42
59 0.41
60 0.4
61 0.43
62 0.41
63 0.41
64 0.4
65 0.43
66 0.42
67 0.43
68 0.48
69 0.47
70 0.45
71 0.42
72 0.43
73 0.42
74 0.46
75 0.5
76 0.49
77 0.52
78 0.53
79 0.5
80 0.47
81 0.45
82 0.41
83 0.31
84 0.26
85 0.21
86 0.21
87 0.2
88 0.22
89 0.2
90 0.16
91 0.16
92 0.16
93 0.13
94 0.1
95 0.11
96 0.08
97 0.08
98 0.08
99 0.07
100 0.08
101 0.08
102 0.08
103 0.11
104 0.13
105 0.13
106 0.13
107 0.15
108 0.15
109 0.21
110 0.26
111 0.23
112 0.25
113 0.28
114 0.32
115 0.31
116 0.3
117 0.24
118 0.24
119 0.26
120 0.26
121 0.28
122 0.31
123 0.33
124 0.33
125 0.34
126 0.3
127 0.29
128 0.26
129 0.22
130 0.17
131 0.15
132 0.15
133 0.15
134 0.14
135 0.12
136 0.11
137 0.1
138 0.07
139 0.06
140 0.05
141 0.04
142 0.04
143 0.04
144 0.04
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.03
151 0.07
152 0.09
153 0.11
154 0.12
155 0.14
156 0.17
157 0.21
158 0.23
159 0.22
160 0.26
161 0.26
162 0.25
163 0.25
164 0.24
165 0.22
166 0.21
167 0.18
168 0.12
169 0.13
170 0.12
171 0.12
172 0.12
173 0.12
174 0.11
175 0.11
176 0.1
177 0.1
178 0.09
179 0.07
180 0.07
181 0.06
182 0.06
183 0.05
184 0.05
185 0.05
186 0.05
187 0.06
188 0.06
189 0.06
190 0.08
191 0.14
192 0.19
193 0.24
194 0.27
195 0.29
196 0.29
197 0.31
198 0.32
199 0.28
200 0.26
201 0.23
202 0.23
203 0.22
204 0.21
205 0.19
206 0.17
207 0.15
208 0.12
209 0.11
210 0.13
211 0.15
212 0.2
213 0.21
214 0.22
215 0.23
216 0.25
217 0.25
218 0.25
219 0.28
220 0.29
221 0.27
222 0.28
223 0.27
224 0.25
225 0.24
226 0.2
227 0.15
228 0.12
229 0.14
230 0.13
231 0.13
232 0.17
233 0.23
234 0.26
235 0.34
236 0.35
237 0.41
238 0.51
239 0.62
240 0.66
241 0.68
242 0.73
243 0.74
244 0.81
245 0.83
246 0.83
247 0.81
248 0.82
249 0.83
250 0.83
251 0.76
252 0.69
253 0.7
254 0.62
255 0.55
256 0.51
257 0.47
258 0.43
259 0.43
260 0.42
261 0.39
262 0.37
263 0.34
264 0.31
265 0.27
266 0.27
267 0.27
268 0.26
269 0.22
270 0.28
271 0.28