Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D9NH31

Protein Details
Accession A0A0D9NH31   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
16-43QVPAPKPPPTPKARRRARGKGNRADQFCHydrophilic
NLS Segment(s)
PositionSequence
20-37PKPPPTPKARRRARGKGN
Subcellular Location(s) cyto 16, cyto_nucl 13.5, nucl 9
Family & Domain DBs
Amino Acid Sequences MEHMSLGRDGADAAVQVPAPKPPPTPKARRRARGKGNRADQFCIYRTSDGQNAPAVAIEYKAPHKLSLDEITTGLGAEIQPERDVINKTDHGFAFTARRLAAAVITQLFSYMIGKGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.09
5 0.11
6 0.14
7 0.16
8 0.2
9 0.26
10 0.35
11 0.43
12 0.53
13 0.59
14 0.67
15 0.75
16 0.8
17 0.83
18 0.85
19 0.87
20 0.87
21 0.88
22 0.87
23 0.86
24 0.83
25 0.76
26 0.69
27 0.6
28 0.53
29 0.44
30 0.38
31 0.3
32 0.24
33 0.22
34 0.21
35 0.23
36 0.2
37 0.2
38 0.17
39 0.16
40 0.14
41 0.13
42 0.11
43 0.07
44 0.07
45 0.06
46 0.06
47 0.07
48 0.1
49 0.1
50 0.1
51 0.11
52 0.12
53 0.15
54 0.17
55 0.17
56 0.15
57 0.15
58 0.15
59 0.14
60 0.12
61 0.09
62 0.06
63 0.04
64 0.05
65 0.06
66 0.06
67 0.07
68 0.07
69 0.08
70 0.11
71 0.13
72 0.13
73 0.18
74 0.21
75 0.22
76 0.27
77 0.27
78 0.26
79 0.24
80 0.24
81 0.24
82 0.23
83 0.23
84 0.19
85 0.19
86 0.17
87 0.17
88 0.16
89 0.12
90 0.13
91 0.12
92 0.12
93 0.12
94 0.12
95 0.12
96 0.11
97 0.11