Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D9P2R9

Protein Details
Accession A0A0D9P2R9   
Localization Confidence High
Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
31-52PDGPWRRKVTKIKKDLIQKAKVHydrophilic
NLS Segment(s)
PositionSequence
17-61KKPKRGFRVGPDNLPDGPWRRKVTKIKKDLIQKAKVKKEYAKIKA
123-187RRTRRPGYYDKQLKKAEERKKESEQRALEIQQRREERERRLAERERFKKAMAKTIGRDGKKKLGR
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MAPKRPLESGDPSLEAKKPKRGFRVGPDNLPDGPWRRKVTKIKKDLIQKAKVKKEYAKIKAREQQKDDNDDGVNSQDEAPKSQEEEQEKMHPTRELMLKDEDKAQAGADTGASADPTSDGMRRRTRRPGYYDKQLKKAEERKKESEQRALEIQQRREERERRLAERERFKKAMAKTIGRDGKKKLGRESTILLDKVKRIMEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.4
4 0.45
5 0.48
6 0.54
7 0.61
8 0.66
9 0.69
10 0.71
11 0.77
12 0.73
13 0.72
14 0.68
15 0.62
16 0.54
17 0.48
18 0.42
19 0.37
20 0.37
21 0.38
22 0.4
23 0.4
24 0.49
25 0.59
26 0.66
27 0.7
28 0.73
29 0.73
30 0.74
31 0.81
32 0.82
33 0.8
34 0.78
35 0.76
36 0.75
37 0.77
38 0.76
39 0.71
40 0.67
41 0.67
42 0.68
43 0.69
44 0.69
45 0.65
46 0.68
47 0.7
48 0.72
49 0.71
50 0.66
51 0.66
52 0.62
53 0.64
54 0.57
55 0.53
56 0.44
57 0.36
58 0.31
59 0.23
60 0.18
61 0.12
62 0.11
63 0.11
64 0.11
65 0.13
66 0.14
67 0.13
68 0.15
69 0.17
70 0.21
71 0.21
72 0.23
73 0.24
74 0.28
75 0.3
76 0.29
77 0.27
78 0.23
79 0.2
80 0.22
81 0.24
82 0.2
83 0.19
84 0.23
85 0.22
86 0.22
87 0.25
88 0.21
89 0.17
90 0.16
91 0.13
92 0.09
93 0.09
94 0.08
95 0.05
96 0.05
97 0.04
98 0.04
99 0.04
100 0.04
101 0.03
102 0.03
103 0.04
104 0.06
105 0.08
106 0.11
107 0.17
108 0.26
109 0.3
110 0.35
111 0.45
112 0.51
113 0.56
114 0.61
115 0.65
116 0.63
117 0.7
118 0.75
119 0.7
120 0.71
121 0.68
122 0.63
123 0.62
124 0.65
125 0.64
126 0.64
127 0.67
128 0.65
129 0.71
130 0.77
131 0.73
132 0.73
133 0.65
134 0.59
135 0.56
136 0.52
137 0.5
138 0.48
139 0.47
140 0.46
141 0.47
142 0.49
143 0.53
144 0.56
145 0.56
146 0.59
147 0.61
148 0.59
149 0.65
150 0.68
151 0.68
152 0.73
153 0.72
154 0.7
155 0.65
156 0.62
157 0.6
158 0.54
159 0.54
160 0.51
161 0.52
162 0.47
163 0.55
164 0.62
165 0.59
166 0.6
167 0.56
168 0.59
169 0.58
170 0.61
171 0.59
172 0.61
173 0.6
174 0.6
175 0.59
176 0.57
177 0.58
178 0.54
179 0.48
180 0.42
181 0.4
182 0.4