Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D9PHT3

Protein Details
Accession A0A0D9PHT3    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-39RASAAKKVRRKRSELARNKISKHydrophilic
NLS Segment(s)
PositionSequence
11-79SKNRLAARASAAKKVRRKRSELARNKISKQDIARGARPGILPTSGPRAKVSAKKARKLEKKMGYALKRR
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
Amino Acid Sequences MPSVKNPNGPSKNRLAARASAAKKVRRKRSELARNKISKQDIARGARPGILPTSGPRAKVSAKKARKLEKKMGYALKRRMEAEGEKQMLDAPDVDAEVEKQLNAENDMDIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.52
3 0.47
4 0.48
5 0.52
6 0.46
7 0.46
8 0.5
9 0.53
10 0.58
11 0.64
12 0.68
13 0.66
14 0.71
15 0.72
16 0.77
17 0.8
18 0.82
19 0.81
20 0.8
21 0.78
22 0.74
23 0.72
24 0.63
25 0.57
26 0.49
27 0.47
28 0.44
29 0.43
30 0.43
31 0.38
32 0.36
33 0.34
34 0.32
35 0.25
36 0.18
37 0.14
38 0.12
39 0.11
40 0.18
41 0.17
42 0.18
43 0.17
44 0.18
45 0.22
46 0.27
47 0.34
48 0.36
49 0.42
50 0.48
51 0.55
52 0.63
53 0.68
54 0.7
55 0.72
56 0.7
57 0.69
58 0.69
59 0.7
60 0.68
61 0.67
62 0.67
63 0.63
64 0.57
65 0.53
66 0.48
67 0.43
68 0.4
69 0.39
70 0.39
71 0.35
72 0.32
73 0.32
74 0.32
75 0.28
76 0.24
77 0.17
78 0.1
79 0.09
80 0.09
81 0.09
82 0.08
83 0.08
84 0.1
85 0.1
86 0.09
87 0.08
88 0.11
89 0.13
90 0.14
91 0.15