Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D9P847

Protein Details
Accession A0A0D9P847    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
313-345AKEPPQTSPRNGKPKKEKKLPPVGRTARKTRSQHydrophilic
NLS Segment(s)
PositionSequence
321-343PRNGKPKKEKKLPPVGRTARKTR
Subcellular Location(s) cyto_nucl 13.833, cyto 13, nucl 12.5, mito_nucl 7.166
Family & Domain DBs
Amino Acid Sequences MTDTNVPAVEKVSGLGPDDSKPRVGAAPPEGQPFLAVCPPAPAHRNEKDEAGLTDKSGDKPAEGLVQSAGENKINGGTGHSSTLPKPVEVMSVPETPVNGSTPAGGTPRPELTISEDPAPSAPEPPSEPIIEPVEVTGAEKPKPAPPTSAPDEKHTSSSSDAPAPREEPVQQSSVAQAPEPPMNDSPASGAMDVDKHEEKQPAPVTHTGPESEPVPAPAPAPAEIPDAPPNTTAEPNDNAVGEKRKLDNVAPPVDGSSATAKDPAASDPLPVDKKPKLDGSAAANGQAAKAAATSDPASSADPASDPAPAETAKEPPQTSPRNGKPKKEKKLPPVGRTARKTRSQGPADA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.16
4 0.19
5 0.24
6 0.25
7 0.24
8 0.23
9 0.23
10 0.23
11 0.24
12 0.27
13 0.28
14 0.34
15 0.35
16 0.39
17 0.37
18 0.34
19 0.32
20 0.26
21 0.23
22 0.19
23 0.17
24 0.13
25 0.17
26 0.18
27 0.22
28 0.25
29 0.27
30 0.32
31 0.39
32 0.44
33 0.42
34 0.43
35 0.4
36 0.4
37 0.37
38 0.33
39 0.26
40 0.22
41 0.24
42 0.24
43 0.23
44 0.25
45 0.23
46 0.18
47 0.19
48 0.2
49 0.21
50 0.19
51 0.18
52 0.15
53 0.15
54 0.15
55 0.17
56 0.17
57 0.13
58 0.12
59 0.12
60 0.12
61 0.12
62 0.12
63 0.12
64 0.12
65 0.12
66 0.14
67 0.16
68 0.17
69 0.16
70 0.23
71 0.22
72 0.19
73 0.19
74 0.18
75 0.19
76 0.17
77 0.21
78 0.18
79 0.19
80 0.19
81 0.19
82 0.18
83 0.16
84 0.16
85 0.14
86 0.1
87 0.09
88 0.09
89 0.09
90 0.1
91 0.11
92 0.11
93 0.11
94 0.12
95 0.14
96 0.14
97 0.14
98 0.14
99 0.2
100 0.24
101 0.25
102 0.25
103 0.24
104 0.23
105 0.23
106 0.24
107 0.17
108 0.14
109 0.12
110 0.11
111 0.13
112 0.15
113 0.17
114 0.16
115 0.16
116 0.16
117 0.18
118 0.16
119 0.14
120 0.12
121 0.11
122 0.09
123 0.1
124 0.1
125 0.1
126 0.1
127 0.12
128 0.13
129 0.17
130 0.21
131 0.21
132 0.22
133 0.23
134 0.3
135 0.34
136 0.4
137 0.37
138 0.38
139 0.42
140 0.38
141 0.38
142 0.32
143 0.28
144 0.22
145 0.24
146 0.21
147 0.2
148 0.21
149 0.2
150 0.21
151 0.2
152 0.19
153 0.18
154 0.17
155 0.16
156 0.16
157 0.16
158 0.15
159 0.14
160 0.14
161 0.15
162 0.14
163 0.11
164 0.1
165 0.1
166 0.12
167 0.12
168 0.13
169 0.11
170 0.13
171 0.13
172 0.12
173 0.11
174 0.11
175 0.11
176 0.09
177 0.08
178 0.07
179 0.08
180 0.08
181 0.1
182 0.1
183 0.1
184 0.13
185 0.15
186 0.15
187 0.21
188 0.27
189 0.25
190 0.27
191 0.3
192 0.29
193 0.29
194 0.3
195 0.24
196 0.19
197 0.18
198 0.16
199 0.14
200 0.12
201 0.11
202 0.12
203 0.11
204 0.11
205 0.11
206 0.12
207 0.11
208 0.12
209 0.11
210 0.13
211 0.13
212 0.15
213 0.18
214 0.18
215 0.18
216 0.18
217 0.18
218 0.17
219 0.18
220 0.17
221 0.16
222 0.17
223 0.18
224 0.18
225 0.17
226 0.15
227 0.16
228 0.21
229 0.18
230 0.2
231 0.2
232 0.22
233 0.23
234 0.24
235 0.28
236 0.29
237 0.31
238 0.28
239 0.27
240 0.25
241 0.24
242 0.22
243 0.17
244 0.14
245 0.12
246 0.12
247 0.13
248 0.12
249 0.12
250 0.13
251 0.13
252 0.14
253 0.13
254 0.14
255 0.14
256 0.2
257 0.22
258 0.22
259 0.27
260 0.26
261 0.29
262 0.32
263 0.35
264 0.32
265 0.32
266 0.35
267 0.36
268 0.4
269 0.37
270 0.34
271 0.3
272 0.27
273 0.24
274 0.21
275 0.15
276 0.07
277 0.07
278 0.07
279 0.06
280 0.09
281 0.1
282 0.09
283 0.1
284 0.11
285 0.12
286 0.13
287 0.13
288 0.11
289 0.1
290 0.12
291 0.11
292 0.12
293 0.11
294 0.11
295 0.13
296 0.12
297 0.15
298 0.15
299 0.19
300 0.24
301 0.29
302 0.29
303 0.32
304 0.42
305 0.45
306 0.51
307 0.57
308 0.61
309 0.66
310 0.72
311 0.78
312 0.8
313 0.84
314 0.88
315 0.88
316 0.88
317 0.87
318 0.92
319 0.92
320 0.87
321 0.87
322 0.87
323 0.86
324 0.84
325 0.83
326 0.81
327 0.79
328 0.79
329 0.76
330 0.76