Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HRX3

Protein Details
Accession C6HRX3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
112-140IENDKPTEPKPKPKPKPKPKKTVGQKVLDBasic
NLS Segment(s)
PositionSequence
120-133PKPKPKPKPKPKKT
Subcellular Location(s) extr 15, mito 5, plas 4, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000064  NLP_P60_dom  
IPR038765  Papain-like_cys_pep_sf  
Pfam View protein in Pfam  
PF00877  NLPC_P60  
PROSITE View protein in PROSITE  
PS51935  NLPC_P60  
Amino Acid Sequences MRFSTFSLALLLGSVVFATPAVELFERKVGSSCKTMDGMGTCMARSKCNGVYYDGACGKNSGETRCCVEVKCKVGGKSGLCQNINRTKCKGGKFHVGNSSTCPAGKDVQCCIENDKPTEPKPKPKPKPKPKKTVGQKVLDIAMKEKGTKYVWGGGSCKGPTKGGYDCSGLVAYAVCKATKRNLFKEGLRVTYSMYCASSSRLGKFKKVPFSKRRAGDAVFFGTSCSCKNQNISHMGLMINSGDRMLHAPNPSTVVREGKVSAQGSLKACPYVIRFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.05
8 0.07
9 0.08
10 0.09
11 0.11
12 0.16
13 0.16
14 0.17
15 0.2
16 0.21
17 0.24
18 0.28
19 0.28
20 0.27
21 0.28
22 0.27
23 0.26
24 0.25
25 0.23
26 0.22
27 0.21
28 0.17
29 0.22
30 0.23
31 0.22
32 0.22
33 0.24
34 0.25
35 0.28
36 0.3
37 0.27
38 0.32
39 0.31
40 0.36
41 0.36
42 0.32
43 0.29
44 0.28
45 0.24
46 0.25
47 0.27
48 0.24
49 0.22
50 0.23
51 0.27
52 0.3
53 0.31
54 0.27
55 0.3
56 0.32
57 0.34
58 0.38
59 0.38
60 0.35
61 0.39
62 0.43
63 0.39
64 0.39
65 0.41
66 0.41
67 0.38
68 0.39
69 0.41
70 0.45
71 0.47
72 0.45
73 0.42
74 0.42
75 0.47
76 0.52
77 0.51
78 0.47
79 0.53
80 0.53
81 0.56
82 0.56
83 0.53
84 0.47
85 0.44
86 0.41
87 0.31
88 0.27
89 0.22
90 0.16
91 0.19
92 0.21
93 0.19
94 0.2
95 0.24
96 0.25
97 0.24
98 0.28
99 0.28
100 0.28
101 0.27
102 0.3
103 0.29
104 0.32
105 0.41
106 0.38
107 0.44
108 0.52
109 0.61
110 0.66
111 0.74
112 0.82
113 0.83
114 0.92
115 0.92
116 0.92
117 0.87
118 0.87
119 0.86
120 0.86
121 0.82
122 0.75
123 0.66
124 0.57
125 0.53
126 0.44
127 0.34
128 0.24
129 0.2
130 0.15
131 0.15
132 0.13
133 0.13
134 0.13
135 0.14
136 0.14
137 0.17
138 0.19
139 0.2
140 0.21
141 0.2
142 0.23
143 0.22
144 0.23
145 0.18
146 0.17
147 0.16
148 0.18
149 0.18
150 0.18
151 0.19
152 0.18
153 0.18
154 0.18
155 0.17
156 0.13
157 0.11
158 0.09
159 0.07
160 0.08
161 0.08
162 0.07
163 0.08
164 0.1
165 0.17
166 0.25
167 0.31
168 0.33
169 0.39
170 0.43
171 0.44
172 0.52
173 0.48
174 0.43
175 0.39
176 0.34
177 0.3
178 0.29
179 0.28
180 0.2
181 0.17
182 0.14
183 0.13
184 0.15
185 0.2
186 0.2
187 0.22
188 0.29
189 0.3
190 0.35
191 0.43
192 0.47
193 0.52
194 0.58
195 0.65
196 0.67
197 0.74
198 0.77
199 0.73
200 0.72
201 0.67
202 0.6
203 0.53
204 0.48
205 0.43
206 0.35
207 0.3
208 0.24
209 0.21
210 0.2
211 0.17
212 0.18
213 0.17
214 0.19
215 0.24
216 0.29
217 0.35
218 0.39
219 0.41
220 0.37
221 0.36
222 0.33
223 0.28
224 0.23
225 0.17
226 0.13
227 0.09
228 0.08
229 0.07
230 0.07
231 0.09
232 0.11
233 0.15
234 0.17
235 0.18
236 0.2
237 0.24
238 0.24
239 0.25
240 0.26
241 0.26
242 0.24
243 0.25
244 0.26
245 0.25
246 0.31
247 0.29
248 0.29
249 0.28
250 0.32
251 0.31
252 0.33
253 0.32
254 0.25
255 0.25
256 0.26