Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D9NQL8

Protein Details
Accession A0A0D9NQL8    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
38-63VMAEQRRYSRKPRRVKRFLDDFKRNEHydrophilic
NLS Segment(s)
PositionSequence
47-51RKPRR
Subcellular Location(s) nucl 13, plas 5, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004841  AA-permease/SLC12A_dom  
IPR004840  Amoino_acid_permease_CS  
Gene Ontology GO:0016020  C:membrane  
GO:0006865  P:amino acid transport  
GO:0055085  P:transmembrane transport  
Pfam View protein in Pfam  
PF00324  AA_permease  
PROSITE View protein in PROSITE  
PS00218  AMINO_ACID_PERMEASE_1  
Amino Acid Sequences MPLFPPGPPRKSPSPSPTPSTDLESPPDVDEAVGDGLVMAEQRRYSRKPRRVKRFLDDFKRNESDRFFPQHYLSPANSRTRHAQRDYGGYFAELELAQSGLARRLKGRHLQMIAISGSIGTGLFVTSGAALATSGPASLLLAFAAAGISMYCTCQALGELAVVFPIAGSFSSWATRFLDASWGFALGWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.65
3 0.67
4 0.65
5 0.6
6 0.56
7 0.53
8 0.48
9 0.41
10 0.39
11 0.35
12 0.32
13 0.28
14 0.27
15 0.2
16 0.15
17 0.13
18 0.11
19 0.09
20 0.07
21 0.06
22 0.05
23 0.05
24 0.05
25 0.05
26 0.04
27 0.05
28 0.07
29 0.1
30 0.16
31 0.2
32 0.31
33 0.41
34 0.51
35 0.61
36 0.7
37 0.79
38 0.83
39 0.87
40 0.85
41 0.86
42 0.86
43 0.85
44 0.84
45 0.75
46 0.73
47 0.7
48 0.62
49 0.53
50 0.47
51 0.41
52 0.37
53 0.4
54 0.34
55 0.31
56 0.32
57 0.34
58 0.33
59 0.32
60 0.28
61 0.27
62 0.3
63 0.35
64 0.34
65 0.32
66 0.37
67 0.41
68 0.46
69 0.43
70 0.44
71 0.38
72 0.44
73 0.42
74 0.35
75 0.29
76 0.22
77 0.2
78 0.15
79 0.14
80 0.06
81 0.06
82 0.04
83 0.04
84 0.04
85 0.04
86 0.05
87 0.08
88 0.1
89 0.1
90 0.11
91 0.14
92 0.18
93 0.24
94 0.28
95 0.3
96 0.29
97 0.3
98 0.29
99 0.29
100 0.25
101 0.19
102 0.15
103 0.09
104 0.07
105 0.06
106 0.05
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.04
120 0.03
121 0.03
122 0.03
123 0.03
124 0.04
125 0.04
126 0.04
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.04
136 0.04
137 0.05
138 0.05
139 0.06
140 0.06
141 0.06
142 0.07
143 0.07
144 0.07
145 0.08
146 0.08
147 0.07
148 0.07
149 0.07
150 0.06
151 0.05
152 0.04
153 0.04
154 0.04
155 0.05
156 0.06
157 0.07
158 0.11
159 0.12
160 0.14
161 0.16
162 0.17
163 0.17
164 0.16
165 0.24
166 0.21
167 0.23
168 0.22
169 0.2