Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C6H656

Protein Details
Accession C6H656    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
56-81CASFWARSRRKTIPKRKWVAKNSMHLHydrophilic
NLS Segment(s)
PositionSequence
64-72RRKTIPKRK
Subcellular Location(s) plas 23, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIFDALCSVLIFLTCHVPPLGASCFDILLFPRFLLALGCSVLSVFFLPFTVLLDPCASFWARSRRKTIPKRKWVAKNSMHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.12
4 0.12
5 0.11
6 0.15
7 0.16
8 0.13
9 0.13
10 0.12
11 0.12
12 0.12
13 0.13
14 0.1
15 0.1
16 0.1
17 0.09
18 0.08
19 0.08
20 0.08
21 0.08
22 0.07
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.04
31 0.03
32 0.03
33 0.03
34 0.04
35 0.04
36 0.05
37 0.06
38 0.06
39 0.07
40 0.08
41 0.08
42 0.08
43 0.1
44 0.1
45 0.09
46 0.15
47 0.25
48 0.32
49 0.36
50 0.43
51 0.51
52 0.62
53 0.72
54 0.78
55 0.78
56 0.82
57 0.87
58 0.9
59 0.91
60 0.89
61 0.89