Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D9P7W7

Protein Details
Accession A0A0D9P7W7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-84RAVPKNKVSHSRKRHRQMAGKABasic
NLS Segment(s)
PositionSequence
74-76RKR
Subcellular Location(s) mito 20, cyto 3, plas 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MAAATASMLSRLPFPTVTSAPRWATFYTRFFNPRLFPTLSVAVPGVSLNIPTLLGDIWESVLRAVPKNKVSHSRKRHRQMAGKALKDVNSLCKCPGCGETKRTHRLCQRCLEDMRRIWRDDYPTNKPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.19
3 0.22
4 0.25
5 0.26
6 0.31
7 0.31
8 0.32
9 0.33
10 0.29
11 0.31
12 0.33
13 0.34
14 0.32
15 0.35
16 0.36
17 0.35
18 0.39
19 0.36
20 0.34
21 0.35
22 0.33
23 0.29
24 0.3
25 0.32
26 0.27
27 0.25
28 0.21
29 0.15
30 0.13
31 0.12
32 0.09
33 0.05
34 0.06
35 0.05
36 0.05
37 0.05
38 0.04
39 0.05
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.05
46 0.05
47 0.04
48 0.06
49 0.07
50 0.09
51 0.11
52 0.14
53 0.18
54 0.2
55 0.23
56 0.32
57 0.38
58 0.47
59 0.55
60 0.62
61 0.69
62 0.75
63 0.8
64 0.78
65 0.8
66 0.78
67 0.78
68 0.75
69 0.67
70 0.62
71 0.55
72 0.48
73 0.41
74 0.34
75 0.33
76 0.28
77 0.27
78 0.26
79 0.25
80 0.25
81 0.25
82 0.29
83 0.26
84 0.28
85 0.33
86 0.41
87 0.49
88 0.58
89 0.59
90 0.63
91 0.66
92 0.69
93 0.7
94 0.7
95 0.67
96 0.65
97 0.69
98 0.67
99 0.66
100 0.64
101 0.67
102 0.62
103 0.59
104 0.54
105 0.52
106 0.53
107 0.53
108 0.55