Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D9NLY6

Protein Details
Accession A0A0D9NLY6    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
145-172QDPEQAGKSDKKKKRGKKKKKKKDSGRGBasic
NLS Segment(s)
PositionSequence
152-172KSDKKKKRGKKKKKKKDSGRG
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MPDAHTHAASSSRRDSSPHGRPQHAGASGGPAGHDVILESLAAQHRSLRRMDSVRHGVVFQMMPRGFRQRYSNELRRRGDQLAQQYGQRQGELAQEQALAQGPFAPGEVYEYIHHSRWAAVAESEQLTDVKWSEWAQGLLEEESQDPEQAGKSDKKKKRGKKKKKKKDSGRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.4
3 0.43
4 0.51
5 0.55
6 0.56
7 0.56
8 0.57
9 0.59
10 0.58
11 0.5
12 0.41
13 0.32
14 0.29
15 0.26
16 0.25
17 0.2
18 0.14
19 0.12
20 0.11
21 0.1
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.07
28 0.09
29 0.1
30 0.1
31 0.14
32 0.17
33 0.2
34 0.21
35 0.21
36 0.25
37 0.28
38 0.31
39 0.35
40 0.39
41 0.38
42 0.37
43 0.35
44 0.29
45 0.27
46 0.24
47 0.16
48 0.17
49 0.16
50 0.16
51 0.18
52 0.25
53 0.23
54 0.25
55 0.3
56 0.26
57 0.33
58 0.41
59 0.48
60 0.5
61 0.58
62 0.57
63 0.55
64 0.56
65 0.5
66 0.45
67 0.4
68 0.37
69 0.34
70 0.33
71 0.31
72 0.29
73 0.3
74 0.27
75 0.23
76 0.16
77 0.12
78 0.15
79 0.15
80 0.13
81 0.1
82 0.09
83 0.1
84 0.1
85 0.1
86 0.07
87 0.06
88 0.07
89 0.07
90 0.06
91 0.07
92 0.06
93 0.04
94 0.07
95 0.08
96 0.08
97 0.09
98 0.13
99 0.15
100 0.16
101 0.16
102 0.14
103 0.14
104 0.13
105 0.14
106 0.11
107 0.1
108 0.1
109 0.12
110 0.12
111 0.12
112 0.11
113 0.09
114 0.09
115 0.09
116 0.09
117 0.07
118 0.09
119 0.1
120 0.11
121 0.13
122 0.14
123 0.13
124 0.14
125 0.15
126 0.14
127 0.14
128 0.13
129 0.11
130 0.14
131 0.13
132 0.12
133 0.11
134 0.11
135 0.11
136 0.12
137 0.17
138 0.22
139 0.31
140 0.42
141 0.49
142 0.59
143 0.68
144 0.77
145 0.84
146 0.88
147 0.9
148 0.91
149 0.95
150 0.96
151 0.97
152 0.98