Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7SAS8

Protein Details
Accession R7SAS8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
128-151DNERKSLTFKEKKHRRDNGLCLYCHydrophilic
NLS Segment(s)
PositionSequence
123-142PKAKSDNERKSLTFKEKKHR
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG tms:TREMEDRAFT_65299  -  
Amino Acid Sequences MPDYYSTFLSISADIDWDDQALKDAFESGLSREIRIALANREHQPKTLRDLAKAAISLYVHLDGVKVASNGNNGSGGGYQQNKDNTKNNLNINKGNSDNTFQKFKSGQQNKTNDNKERKSQNPKAKSDNERKSLTFKEKKHRRDNGLCLYCGSPDHMVINCPEAKKRPTPATGANRIGLNSLTIEGPNNGQDKDCHGRRTTSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.09
5 0.09
6 0.08
7 0.11
8 0.11
9 0.1
10 0.09
11 0.1
12 0.1
13 0.11
14 0.12
15 0.1
16 0.17
17 0.17
18 0.18
19 0.17
20 0.18
21 0.17
22 0.19
23 0.2
24 0.18
25 0.23
26 0.28
27 0.33
28 0.39
29 0.39
30 0.4
31 0.42
32 0.4
33 0.41
34 0.45
35 0.41
36 0.36
37 0.38
38 0.36
39 0.34
40 0.31
41 0.25
42 0.18
43 0.16
44 0.14
45 0.13
46 0.12
47 0.09
48 0.09
49 0.09
50 0.06
51 0.07
52 0.08
53 0.06
54 0.06
55 0.07
56 0.09
57 0.09
58 0.1
59 0.09
60 0.08
61 0.08
62 0.08
63 0.08
64 0.09
65 0.11
66 0.11
67 0.14
68 0.2
69 0.22
70 0.25
71 0.3
72 0.32
73 0.36
74 0.41
75 0.43
76 0.44
77 0.45
78 0.45
79 0.41
80 0.39
81 0.34
82 0.31
83 0.26
84 0.23
85 0.24
86 0.23
87 0.25
88 0.22
89 0.24
90 0.23
91 0.27
92 0.35
93 0.38
94 0.44
95 0.48
96 0.55
97 0.57
98 0.65
99 0.67
100 0.64
101 0.65
102 0.6
103 0.59
104 0.6
105 0.62
106 0.64
107 0.67
108 0.69
109 0.69
110 0.71
111 0.72
112 0.73
113 0.74
114 0.74
115 0.73
116 0.69
117 0.64
118 0.6
119 0.57
120 0.55
121 0.56
122 0.54
123 0.52
124 0.57
125 0.64
126 0.72
127 0.77
128 0.8
129 0.79
130 0.8
131 0.82
132 0.82
133 0.77
134 0.68
135 0.59
136 0.51
137 0.42
138 0.33
139 0.27
140 0.17
141 0.13
142 0.15
143 0.13
144 0.14
145 0.14
146 0.18
147 0.18
148 0.19
149 0.22
150 0.25
151 0.29
152 0.35
153 0.41
154 0.44
155 0.45
156 0.49
157 0.55
158 0.59
159 0.63
160 0.6
161 0.55
162 0.49
163 0.46
164 0.41
165 0.31
166 0.23
167 0.15
168 0.12
169 0.11
170 0.1
171 0.11
172 0.11
173 0.13
174 0.16
175 0.18
176 0.18
177 0.18
178 0.19
179 0.25
180 0.34
181 0.38
182 0.39
183 0.4