Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7SA91

Protein Details
Accession R7SA91    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
20-45RENPLSAKKREKTKKKSNLAGRTPYLHydrophilic
NLS Segment(s)
PositionSequence
26-36AKKREKTKKKS
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, mito 9, cyto 7.5
Family & Domain DBs
KEGG tms:TREMEDRAFT_65830  -  
Amino Acid Sequences MCKGARGPGTSEFFSPIGGRENPLSAKKREKTKKKSNLAGRTPYLGDFEQPKTRFKSAFPLTVPLTVPLTVPPTVPPTVPPGVPPGDPPARDPPARDPPARDSPLLARTRLPRGLSRKLSRHLLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.25
3 0.18
4 0.19
5 0.18
6 0.19
7 0.17
8 0.2
9 0.23
10 0.3
11 0.33
12 0.33
13 0.42
14 0.46
15 0.56
16 0.63
17 0.7
18 0.74
19 0.8
20 0.85
21 0.85
22 0.89
23 0.88
24 0.88
25 0.84
26 0.81
27 0.71
28 0.63
29 0.54
30 0.45
31 0.38
32 0.27
33 0.21
34 0.18
35 0.2
36 0.25
37 0.26
38 0.28
39 0.3
40 0.32
41 0.31
42 0.28
43 0.35
44 0.3
45 0.34
46 0.31
47 0.31
48 0.29
49 0.3
50 0.29
51 0.2
52 0.18
53 0.13
54 0.12
55 0.09
56 0.11
57 0.09
58 0.09
59 0.1
60 0.12
61 0.13
62 0.13
63 0.13
64 0.15
65 0.17
66 0.17
67 0.16
68 0.16
69 0.18
70 0.18
71 0.18
72 0.19
73 0.22
74 0.22
75 0.25
76 0.3
77 0.32
78 0.33
79 0.35
80 0.37
81 0.43
82 0.48
83 0.46
84 0.43
85 0.46
86 0.55
87 0.55
88 0.47
89 0.39
90 0.39
91 0.46
92 0.44
93 0.38
94 0.34
95 0.36
96 0.42
97 0.45
98 0.43
99 0.42
100 0.47
101 0.56
102 0.61
103 0.65
104 0.66
105 0.68
106 0.72