Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SAY9

Protein Details
Accession R7SAY9    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
131-163EHTKSPMERLIKKKRRKGYKKTIEHKQGWTRLRBasic
NLS Segment(s)
PositionSequence
139-152RLIKKKRRKGYKKT
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005840  C:ribosome  
KEGG tms:TREMEDRAFT_35580  -  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences SPSLSPIPSLPPLLPPQIDPLPTTTPSALSLLKSSSTPQSGLYILARLHSRTYLLHPRDILTLPTLKPVQEPGTKLSLTRILEVGSREHSIRSPAADGKTLRKSLQFSPTTGKEWEYIPDWIVKCQVTVLEHTKSPMERLIKKKRRKGYKKTIEHKQGWTRLRVGDIVLGDGVSPES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.25
3 0.29
4 0.3
5 0.31
6 0.27
7 0.27
8 0.27
9 0.28
10 0.29
11 0.23
12 0.21
13 0.21
14 0.23
15 0.19
16 0.16
17 0.16
18 0.15
19 0.15
20 0.15
21 0.16
22 0.18
23 0.18
24 0.18
25 0.17
26 0.18
27 0.18
28 0.19
29 0.17
30 0.15
31 0.13
32 0.15
33 0.16
34 0.14
35 0.15
36 0.14
37 0.14
38 0.13
39 0.2
40 0.27
41 0.28
42 0.3
43 0.3
44 0.3
45 0.32
46 0.31
47 0.25
48 0.18
49 0.19
50 0.16
51 0.2
52 0.19
53 0.16
54 0.16
55 0.18
56 0.21
57 0.2
58 0.22
59 0.21
60 0.24
61 0.24
62 0.23
63 0.22
64 0.22
65 0.2
66 0.19
67 0.17
68 0.13
69 0.15
70 0.16
71 0.15
72 0.12
73 0.12
74 0.12
75 0.12
76 0.12
77 0.12
78 0.12
79 0.11
80 0.11
81 0.13
82 0.14
83 0.17
84 0.18
85 0.21
86 0.26
87 0.27
88 0.25
89 0.25
90 0.27
91 0.28
92 0.36
93 0.32
94 0.29
95 0.33
96 0.35
97 0.35
98 0.32
99 0.3
100 0.21
101 0.21
102 0.21
103 0.18
104 0.16
105 0.14
106 0.19
107 0.18
108 0.18
109 0.2
110 0.18
111 0.15
112 0.15
113 0.16
114 0.12
115 0.16
116 0.2
117 0.19
118 0.2
119 0.21
120 0.23
121 0.22
122 0.22
123 0.23
124 0.26
125 0.32
126 0.41
127 0.52
128 0.59
129 0.69
130 0.76
131 0.81
132 0.85
133 0.88
134 0.89
135 0.89
136 0.9
137 0.91
138 0.91
139 0.92
140 0.91
141 0.86
142 0.84
143 0.82
144 0.8
145 0.75
146 0.7
147 0.63
148 0.55
149 0.51
150 0.43
151 0.34
152 0.29
153 0.24
154 0.21
155 0.18
156 0.15
157 0.12