Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7S919

Protein Details
Accession R7S919    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
72-97APLALPRKRKASRRTPVRRVIRPFDGHydrophilic
NLS Segment(s)
PositionSequence
64-90KERKNNGLAPLALPRKRKASRRTPVRR
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
KEGG tms:TREMEDRAFT_66605  -  
Amino Acid Sequences MSTSRAIASRLRSFKSNAGPRILHTSAQPLEVDDFELGAEEDAKEYAELQELEAERQRVREENKERKNNGLAPLALPRKRKASRRTPVRRVIRPFDGDASDPSEDGTHAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.55
4 0.5
5 0.51
6 0.48
7 0.47
8 0.52
9 0.47
10 0.38
11 0.29
12 0.32
13 0.26
14 0.27
15 0.25
16 0.17
17 0.17
18 0.16
19 0.17
20 0.1
21 0.09
22 0.07
23 0.07
24 0.06
25 0.05
26 0.05
27 0.04
28 0.04
29 0.04
30 0.05
31 0.04
32 0.05
33 0.05
34 0.06
35 0.06
36 0.06
37 0.09
38 0.09
39 0.11
40 0.12
41 0.13
42 0.11
43 0.12
44 0.13
45 0.14
46 0.17
47 0.26
48 0.34
49 0.43
50 0.53
51 0.6
52 0.61
53 0.62
54 0.63
55 0.58
56 0.52
57 0.45
58 0.36
59 0.29
60 0.35
61 0.37
62 0.37
63 0.36
64 0.34
65 0.4
66 0.46
67 0.54
68 0.56
69 0.6
70 0.67
71 0.75
72 0.83
73 0.83
74 0.87
75 0.88
76 0.87
77 0.84
78 0.81
79 0.77
80 0.71
81 0.64
82 0.58
83 0.51
84 0.43
85 0.37
86 0.35
87 0.28
88 0.23
89 0.21
90 0.18