Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7SEH9

Protein Details
Accession R7SEH9    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
274-295VEKMRLRKLIRQEAKRLRQVNEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR002575  Aminoglycoside_PTrfase  
IPR011009  Kinase-like_dom_sf  
KEGG tms:TREMEDRAFT_65040  -  
Pfam View protein in Pfam  
PF01636  APH  
Amino Acid Sequences MSYHHLLTPDLLHEARRNARRRHVHSFQDGITLKFGQGVTKEEYDILQLVHSTGCTFSPVPLEWSTYQECNVIAMTTLPGLPYGHKRIYPGDKESICGDLKRIMDDLNDSLDAMGIRPPYPDQVCSLEGSSCLRLPYFDELGPGPVALEHLVENMTCRTPQLDSLKDRHESILRMLQTDRGVRFCHMDLHPGNILVEGGKVTGIADWEYAGWYTATMEVFAAVCHSHRLRAFASVLISTWGLSSELDNDAQESMSKLYQGTMRAQRENIRAEMVEKMRLRKLIRQEAKRLRQVNETQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.37
3 0.44
4 0.51
5 0.54
6 0.64
7 0.72
8 0.76
9 0.78
10 0.78
11 0.78
12 0.76
13 0.74
14 0.64
15 0.63
16 0.56
17 0.47
18 0.41
19 0.33
20 0.26
21 0.25
22 0.24
23 0.17
24 0.18
25 0.2
26 0.22
27 0.22
28 0.23
29 0.2
30 0.2
31 0.19
32 0.18
33 0.14
34 0.1
35 0.09
36 0.09
37 0.09
38 0.09
39 0.07
40 0.07
41 0.07
42 0.1
43 0.1
44 0.1
45 0.14
46 0.14
47 0.18
48 0.18
49 0.22
50 0.2
51 0.24
52 0.26
53 0.24
54 0.24
55 0.21
56 0.2
57 0.17
58 0.16
59 0.11
60 0.08
61 0.08
62 0.07
63 0.07
64 0.07
65 0.06
66 0.06
67 0.07
68 0.09
69 0.14
70 0.19
71 0.21
72 0.22
73 0.24
74 0.3
75 0.38
76 0.41
77 0.4
78 0.42
79 0.4
80 0.41
81 0.4
82 0.37
83 0.29
84 0.24
85 0.21
86 0.18
87 0.18
88 0.18
89 0.17
90 0.14
91 0.14
92 0.15
93 0.15
94 0.12
95 0.11
96 0.1
97 0.09
98 0.09
99 0.09
100 0.07
101 0.08
102 0.07
103 0.07
104 0.08
105 0.09
106 0.12
107 0.13
108 0.14
109 0.14
110 0.17
111 0.18
112 0.18
113 0.18
114 0.14
115 0.14
116 0.15
117 0.13
118 0.11
119 0.1
120 0.09
121 0.08
122 0.1
123 0.13
124 0.14
125 0.13
126 0.13
127 0.13
128 0.14
129 0.14
130 0.11
131 0.07
132 0.05
133 0.06
134 0.05
135 0.05
136 0.04
137 0.04
138 0.04
139 0.04
140 0.05
141 0.06
142 0.06
143 0.06
144 0.06
145 0.06
146 0.07
147 0.12
148 0.17
149 0.21
150 0.24
151 0.28
152 0.32
153 0.32
154 0.33
155 0.29
156 0.27
157 0.22
158 0.22
159 0.24
160 0.2
161 0.2
162 0.2
163 0.21
164 0.21
165 0.24
166 0.22
167 0.18
168 0.19
169 0.18
170 0.21
171 0.18
172 0.22
173 0.19
174 0.24
175 0.23
176 0.25
177 0.25
178 0.23
179 0.22
180 0.16
181 0.16
182 0.09
183 0.09
184 0.05
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.06
196 0.06
197 0.06
198 0.05
199 0.05
200 0.05
201 0.07
202 0.07
203 0.07
204 0.07
205 0.07
206 0.07
207 0.06
208 0.07
209 0.05
210 0.06
211 0.1
212 0.11
213 0.15
214 0.16
215 0.2
216 0.2
217 0.24
218 0.24
219 0.22
220 0.23
221 0.19
222 0.18
223 0.16
224 0.15
225 0.11
226 0.1
227 0.09
228 0.07
229 0.07
230 0.08
231 0.08
232 0.1
233 0.11
234 0.11
235 0.11
236 0.11
237 0.11
238 0.11
239 0.1
240 0.1
241 0.1
242 0.11
243 0.1
244 0.12
245 0.15
246 0.17
247 0.24
248 0.31
249 0.36
250 0.39
251 0.42
252 0.47
253 0.51
254 0.52
255 0.46
256 0.4
257 0.35
258 0.33
259 0.38
260 0.33
261 0.34
262 0.33
263 0.37
264 0.38
265 0.44
266 0.46
267 0.46
268 0.54
269 0.58
270 0.64
271 0.68
272 0.74
273 0.79
274 0.85
275 0.86
276 0.82
277 0.74