Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SCY8

Protein Details
Accession R7SCY8    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
4-26VPLHCTPPKRLFFKKHKSQFIDHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9, mito 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
IPR038717  Tc1-like_DDE_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG tms:TREMEDRAFT_34745  -  
Pfam View protein in Pfam  
PF13358  DDE_3  
Amino Acid Sequences QDGVPLHCTPPKRLFFKKHKSQFIDHPPSSPDLNPIENCWSIVKHQLVTLPDPLPNIDDLFKVASKLWLEIPQKKIDSYIDSMEERRKAVLKLNRFSTQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.7
3 0.78
4 0.82
5 0.82
6 0.84
7 0.82
8 0.78
9 0.78
10 0.78
11 0.77
12 0.67
13 0.59
14 0.51
15 0.48
16 0.44
17 0.34
18 0.27
19 0.2
20 0.23
21 0.21
22 0.21
23 0.23
24 0.21
25 0.22
26 0.18
27 0.16
28 0.14
29 0.19
30 0.18
31 0.15
32 0.15
33 0.17
34 0.18
35 0.19
36 0.21
37 0.16
38 0.15
39 0.15
40 0.14
41 0.12
42 0.11
43 0.1
44 0.08
45 0.07
46 0.08
47 0.09
48 0.09
49 0.09
50 0.09
51 0.11
52 0.11
53 0.12
54 0.13
55 0.2
56 0.24
57 0.3
58 0.33
59 0.36
60 0.37
61 0.36
62 0.36
63 0.3
64 0.3
65 0.27
66 0.26
67 0.24
68 0.25
69 0.28
70 0.32
71 0.31
72 0.28
73 0.27
74 0.27
75 0.25
76 0.33
77 0.39
78 0.43
79 0.48
80 0.55