Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SBY0

Protein Details
Accession R7SBY0    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-38IGQKEHDADRKRKKKTKTENVQRSGFGBasic
66-94IKYLRSKLAVRRKIRQRQRSTKCHKLPIAHydrophilic
NLS Segment(s)
PositionSequence
21-28RKRKKKTK
76-80RRKIR
Subcellular Location(s) nucl 13.5, cyto_nucl 12, cyto 9.5, mito 4
Family & Domain DBs
KEGG tms:TREMEDRAFT_65386  -  
Amino Acid Sequences MVPVDQVGPMDIGQKEHDADRKRKKKTKTENVQRSGFGPRPEMEKMRSAQWKYFAALFCGYRFRTIKYLRSKLAVRRKIRQRQRSTKCHKLPIADRNMNIHGARSKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.19
4 0.26
5 0.3
6 0.39
7 0.49
8 0.57
9 0.65
10 0.72
11 0.78
12 0.82
13 0.85
14 0.87
15 0.87
16 0.89
17 0.89
18 0.88
19 0.82
20 0.71
21 0.62
22 0.57
23 0.49
24 0.39
25 0.31
26 0.25
27 0.27
28 0.29
29 0.29
30 0.25
31 0.25
32 0.25
33 0.29
34 0.34
35 0.32
36 0.31
37 0.33
38 0.32
39 0.28
40 0.3
41 0.24
42 0.2
43 0.2
44 0.18
45 0.15
46 0.18
47 0.17
48 0.19
49 0.19
50 0.19
51 0.25
52 0.29
53 0.36
54 0.42
55 0.47
56 0.44
57 0.48
58 0.51
59 0.52
60 0.59
61 0.6
62 0.56
63 0.61
64 0.7
65 0.75
66 0.81
67 0.83
68 0.83
69 0.85
70 0.89
71 0.91
72 0.9
73 0.9
74 0.88
75 0.86
76 0.79
77 0.77
78 0.76
79 0.74
80 0.76
81 0.7
82 0.64
83 0.6
84 0.58
85 0.54
86 0.45
87 0.4