Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S9Q1

Protein Details
Accession R7S9Q1    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
46-77EKAKAEKREKERIRKAKQRGRKREMRAKQVKEBasic
NLS Segment(s)
PositionSequence
39-92RKRSVMSEKAKAEKREKERIRKAKQRGRKREMRAKQVKEEVGSSNTGKGKGKGK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
KEGG tms:TREMEDRAFT_66394  -  
Amino Acid Sequences MPQLSPRPQVEPPQQLETQAEIFNRQDREGVAESSSAGRKRSVMSEKAKAEKREKERIRKAKQRGRKREMRAKQVKEEVGSSNTGKGKGKGKEAEEMSEKRITFKRCRNVIARDPTGSVAHHTKIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.49
3 0.47
4 0.4
5 0.34
6 0.28
7 0.23
8 0.2
9 0.21
10 0.25
11 0.25
12 0.22
13 0.21
14 0.19
15 0.24
16 0.23
17 0.22
18 0.18
19 0.16
20 0.16
21 0.18
22 0.21
23 0.17
24 0.16
25 0.16
26 0.16
27 0.18
28 0.24
29 0.27
30 0.31
31 0.35
32 0.42
33 0.46
34 0.52
35 0.56
36 0.54
37 0.55
38 0.56
39 0.57
40 0.6
41 0.64
42 0.67
43 0.72
44 0.77
45 0.8
46 0.8
47 0.84
48 0.82
49 0.84
50 0.84
51 0.85
52 0.82
53 0.82
54 0.82
55 0.82
56 0.81
57 0.82
58 0.81
59 0.75
60 0.72
61 0.69
62 0.62
63 0.52
64 0.47
65 0.38
66 0.3
67 0.28
68 0.22
69 0.21
70 0.21
71 0.22
72 0.21
73 0.22
74 0.28
75 0.29
76 0.36
77 0.37
78 0.37
79 0.42
80 0.42
81 0.43
82 0.42
83 0.4
84 0.37
85 0.37
86 0.34
87 0.32
88 0.36
89 0.38
90 0.42
91 0.49
92 0.56
93 0.57
94 0.64
95 0.66
96 0.69
97 0.72
98 0.72
99 0.67
100 0.6
101 0.55
102 0.51
103 0.46
104 0.38
105 0.33
106 0.28