Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7SBQ9

Protein Details
Accession R7SBQ9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
102-128PIAKTGSSKKKYKKSKGKQKAVDDFESHydrophilic
NLS Segment(s)
PositionSequence
20-24KRRRS
96-121KKQRPVPIAKTGSSKKKYKKSKGKQK
Subcellular Location(s) mito 15.5, mito_nucl 13.333, nucl 10, cyto_nucl 6.333
Family & Domain DBs
KEGG tms:TREMEDRAFT_65291  -  
Amino Acid Sequences MVTRKQLASLKKATEASANKRRRSGSQGRRSGSQVPPVRSPPPVAVAVPNLQKLNECKISGPDFRVPIPHRFGHVVGIQVPDYCNVRWAYSALPDKKQRPVPIAKTGSSKKKYKKSKGKQKAVDDFESDSEPSEPSIEESDEDESKSSHTTTETEEVEGESGNAGEEVEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.49
4 0.52
5 0.58
6 0.56
7 0.6
8 0.62
9 0.59
10 0.61
11 0.62
12 0.63
13 0.65
14 0.7
15 0.68
16 0.68
17 0.66
18 0.64
19 0.57
20 0.56
21 0.52
22 0.47
23 0.49
24 0.5
25 0.48
26 0.43
27 0.41
28 0.33
29 0.3
30 0.27
31 0.23
32 0.2
33 0.21
34 0.23
35 0.23
36 0.24
37 0.2
38 0.19
39 0.2
40 0.21
41 0.25
42 0.25
43 0.23
44 0.21
45 0.25
46 0.3
47 0.29
48 0.31
49 0.28
50 0.26
51 0.25
52 0.31
53 0.3
54 0.31
55 0.33
56 0.3
57 0.28
58 0.28
59 0.28
60 0.25
61 0.23
62 0.19
63 0.15
64 0.16
65 0.14
66 0.12
67 0.12
68 0.1
69 0.1
70 0.09
71 0.11
72 0.1
73 0.11
74 0.11
75 0.11
76 0.11
77 0.15
78 0.23
79 0.22
80 0.28
81 0.33
82 0.35
83 0.41
84 0.45
85 0.41
86 0.4
87 0.46
88 0.45
89 0.5
90 0.5
91 0.46
92 0.48
93 0.51
94 0.55
95 0.53
96 0.56
97 0.55
98 0.61
99 0.7
100 0.74
101 0.8
102 0.81
103 0.87
104 0.9
105 0.92
106 0.91
107 0.9
108 0.89
109 0.84
110 0.75
111 0.66
112 0.57
113 0.48
114 0.41
115 0.31
116 0.22
117 0.17
118 0.14
119 0.12
120 0.11
121 0.1
122 0.1
123 0.12
124 0.11
125 0.11
126 0.12
127 0.16
128 0.16
129 0.16
130 0.15
131 0.13
132 0.14
133 0.15
134 0.13
135 0.11
136 0.12
137 0.13
138 0.17
139 0.23
140 0.23
141 0.22
142 0.22
143 0.22
144 0.2
145 0.19
146 0.14
147 0.09
148 0.07
149 0.07
150 0.06