Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S826

Protein Details
Accession R7S826   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
85-107QGSNGPNGHGRRRRRRRRLRCSDBasic
NLS Segment(s)
PositionSequence
93-103HGRRRRRRRRL
Subcellular Location(s) mito 12, nucl 7.5, cyto_nucl 5.5, cyto 2.5, extr 2, pero 2
Family & Domain DBs
KEGG tms:TREMEDRAFT_66498  -  
Amino Acid Sequences MAPVPLQLPLPLPLRLFGEALIKSKGNRIARDQARPRTGRLKPWALAVGKQKASSVSILTGPVWNDLDLHVMVIVDRGCWSQEEQGSNGPNGHGRRRRRRRRLRCSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.2
4 0.17
5 0.19
6 0.19
7 0.21
8 0.21
9 0.2
10 0.19
11 0.23
12 0.3
13 0.3
14 0.32
15 0.35
16 0.43
17 0.48
18 0.57
19 0.61
20 0.61
21 0.64
22 0.62
23 0.6
24 0.59
25 0.56
26 0.55
27 0.54
28 0.51
29 0.43
30 0.45
31 0.46
32 0.37
33 0.39
34 0.36
35 0.35
36 0.31
37 0.3
38 0.27
39 0.23
40 0.23
41 0.19
42 0.14
43 0.09
44 0.09
45 0.09
46 0.09
47 0.1
48 0.09
49 0.1
50 0.1
51 0.09
52 0.08
53 0.08
54 0.1
55 0.08
56 0.08
57 0.06
58 0.06
59 0.06
60 0.07
61 0.07
62 0.05
63 0.06
64 0.06
65 0.07
66 0.08
67 0.1
68 0.13
69 0.17
70 0.2
71 0.21
72 0.25
73 0.27
74 0.27
75 0.26
76 0.22
77 0.24
78 0.25
79 0.34
80 0.37
81 0.46
82 0.56
83 0.67
84 0.78
85 0.83
86 0.91
87 0.93