FuNGI

R7SBZ1

Protein Details

Accession

R7SBZ1

Localization Confidence

Medium

Confidence Score

12.5

NoLS Segment(s)

Position	Sequence	Protein Nature
349-378	QSERKTFDGPVRRKKRERMMRKTKLAFHTY	Hydrophilic

NLS Segment(s)

Position	Sequence
359-370	VRRKKRERMMRK

Subcellular Location(s)

nucl 17.5, cyto_nucl 12, cyto 5.5, mito 4

Family & Domain DBs

InterPro	View protein in InterPro IPR007175 Rpr2/Snm1/Rpp21
Gene Ontology	GO:1902555 C:endoribonuclease complex GO:1990904 C:ribonucleoprotein complex GO:0034470 P:ncRNA processing
KEGG	tms:TREMEDRAFT_65282 -
Pfam	View protein in Pfam PF04032 Rpr2

Amino Acid Sequences

MKKPKHIESNVKPRIPPIPQKDSYDRLTFTLQASLYLQATSIYSSSTVPSSLPQVPADKYSRSSTSIPKGKVGHATESDSVESERKSPRSSCTKDVSGRSDSGRELKQWLEESRNIHKDVKNVSRPSPDSRKHTKSTEVEQGRIADERRKRSNISESSRYDGAGKNSSDEIYRKRSNTEYGKVEYVLAQLGREAMKQGKIMVKHGQMKLGFIMGLRLIVRDPGLKRNICKQCGTVLIPGLTLKVRNRRAVLLRYSSDTWELGIDQIANKTHITRTTHTCLFCSTQRSIPSPPILLPLSIPPVPSSADLHNITGTTSISTLANTSTSIVSMGSTVPAAPISAIGIREEAQSERKTFDGPVRRKKRERMMRKTKLAFHTYEASLPTSDISASTTNPHDKEANSVILVSSNQTLSTSTSEKDREWKRNTGKVKMGDKVAPMSGEQGDERNGRDGKKGHRLWVNGEEVHGWGIGVPS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.65
2	0.63
3	0.62
4	0.6
5	0.61
6	0.61
7	0.68
8	0.72
9	0.69
10	0.66
11	0.62
12	0.54
13	0.47
14	0.45
15	0.4
16	0.34
17	0.34
18	0.28
19	0.24
20	0.24
21	0.23
22	0.2
23	0.17
24	0.16
25	0.11
26	0.12
27	0.11
28	0.1
29	0.08
30	0.09
31	0.09
32	0.11
33	0.11
34	0.11
35	0.1
36	0.12
37	0.17
38	0.19
39	0.21
40	0.22
41	0.25
42	0.26
43	0.32
44	0.34
45	0.32
46	0.31
47	0.34
48	0.34
49	0.35
50	0.38
51	0.4
52	0.46
53	0.52
54	0.5
55	0.51
56	0.51
57	0.5
58	0.54
59	0.49
60	0.45
61	0.4
62	0.43
63	0.39
64	0.38
65	0.35
66	0.27
67	0.26
68	0.22
69	0.2
70	0.2
71	0.25
72	0.26
73	0.3
74	0.31
75	0.38
76	0.46
77	0.51
78	0.53
79	0.54
80	0.58
81	0.6
82	0.64
83	0.61
84	0.55
85	0.52
86	0.47
87	0.42
88	0.37
89	0.37
90	0.33
91	0.29
92	0.28
93	0.26
94	0.28
95	0.3
96	0.31
97	0.3
98	0.32
99	0.36
100	0.42
101	0.45
102	0.44
103	0.46
104	0.45
105	0.45
106	0.5
107	0.54
108	0.54
109	0.53
110	0.54
111	0.56
112	0.57
113	0.59
114	0.61
115	0.58
116	0.58
117	0.64
118	0.66
119	0.64
120	0.64
121	0.64
122	0.59
123	0.59
124	0.61
125	0.54
126	0.49
127	0.46
128	0.43
129	0.35
130	0.33
131	0.28
132	0.25
133	0.28
134	0.34
135	0.39
136	0.41
137	0.43
138	0.45
139	0.54
140	0.56
141	0.57
142	0.58
143	0.54
144	0.55
145	0.52
146	0.47
147	0.4
148	0.33
149	0.3
150	0.26
151	0.24
152	0.21
153	0.22
154	0.22
155	0.22
156	0.22
157	0.23
158	0.25
159	0.3
160	0.29
161	0.31
162	0.33
163	0.39
164	0.43
165	0.44
166	0.41
167	0.39
168	0.4
169	0.37
170	0.35
171	0.27
172	0.21
173	0.16
174	0.11
175	0.08
176	0.07
177	0.08
178	0.08
179	0.07
180	0.09
181	0.09
182	0.11
183	0.11
184	0.14
185	0.16
186	0.16
187	0.2
188	0.23
189	0.27
190	0.33
191	0.33
192	0.35
193	0.32
194	0.32
195	0.29
196	0.23
197	0.18
198	0.1
199	0.1
200	0.06
201	0.07
202	0.06
203	0.06
204	0.05
205	0.06
206	0.06
207	0.09
208	0.11
209	0.16
210	0.22
211	0.23
212	0.25
213	0.34
214	0.41
215	0.4
216	0.4
217	0.35
218	0.32
219	0.34
220	0.35
221	0.26
222	0.2
223	0.18
224	0.17
225	0.16
226	0.13
227	0.1
228	0.1
229	0.12
230	0.19
231	0.23
232	0.26
233	0.28
234	0.31
235	0.36
236	0.39
237	0.4
238	0.36
239	0.33
240	0.33
241	0.33
242	0.3
243	0.26
244	0.2
245	0.16
246	0.11
247	0.1
248	0.07
249	0.07
250	0.06
251	0.06
252	0.07
253	0.08
254	0.08
255	0.08
256	0.09
257	0.1
258	0.15
259	0.19
260	0.2
261	0.26
262	0.31
263	0.35
264	0.34
265	0.34
266	0.31
267	0.3
268	0.3
269	0.28
270	0.24
271	0.24
272	0.27
273	0.3
274	0.3
275	0.31
276	0.3
277	0.26
278	0.25
279	0.24
280	0.21
281	0.18
282	0.17
283	0.14
284	0.16
285	0.16
286	0.15
287	0.12
288	0.12
289	0.13
290	0.14
291	0.15
292	0.12
293	0.17
294	0.18
295	0.18
296	0.17
297	0.16
298	0.15
299	0.13
300	0.12
301	0.07
302	0.07
303	0.07
304	0.07
305	0.07
306	0.07
307	0.07
308	0.07
309	0.07
310	0.08
311	0.07
312	0.07
313	0.07
314	0.07
315	0.06
316	0.06
317	0.06
318	0.05
319	0.05
320	0.05
321	0.05
322	0.05
323	0.05
324	0.04
325	0.04
326	0.05
327	0.06
328	0.07
329	0.07
330	0.08
331	0.09
332	0.09
333	0.11
334	0.11
335	0.15
336	0.18
337	0.19
338	0.19
339	0.19
340	0.2
341	0.21
342	0.27
343	0.32
344	0.39
345	0.49
346	0.58
347	0.67
348	0.73
349	0.8
350	0.83
351	0.84
352	0.86
353	0.86
354	0.87
355	0.88
356	0.9
357	0.88
358	0.85
359	0.81
360	0.75
361	0.66
362	0.58
363	0.54
364	0.45
365	0.4
366	0.34
367	0.28
368	0.23
369	0.21
370	0.17
371	0.12
372	0.11
373	0.09
374	0.1
375	0.1
376	0.1
377	0.13
378	0.18
379	0.23
380	0.24
381	0.27
382	0.27
383	0.26
384	0.31
385	0.32
386	0.3
387	0.24
388	0.24
389	0.21
390	0.2
391	0.2
392	0.15
393	0.13
394	0.11
395	0.1
396	0.11
397	0.12
398	0.12
399	0.16
400	0.17
401	0.16
402	0.22
403	0.25
404	0.26
405	0.35
406	0.42
407	0.48
408	0.52
409	0.61
410	0.64
411	0.7
412	0.76
413	0.75
414	0.74
415	0.73
416	0.74
417	0.69
418	0.65
419	0.6
420	0.55
421	0.5
422	0.43
423	0.35
424	0.28
425	0.26
426	0.22
427	0.21
428	0.19
429	0.17
430	0.2
431	0.22
432	0.23
433	0.27
434	0.29
435	0.29
436	0.35
437	0.39
438	0.44
439	0.52
440	0.55
441	0.55
442	0.6
443	0.61
444	0.61
445	0.63
446	0.61
447	0.51
448	0.48
449	0.41
450	0.34
451	0.32
452	0.24
453	0.16

R7SBZ1

3D AlphaFold-predicted Structure Viewer