Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S997

Protein Details
Accession R7S997    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
8-32RLDLSRDPRKTLRKLRSHKFTLSNSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 21, mito 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR026841  Aur1/Ipt1  
IPR000326  P_Acid_Pase_2/haloperoxidase  
Gene Ontology GO:0016020  C:membrane  
GO:0006629  P:lipid metabolic process  
KEGG tms:TREMEDRAFT_22906  -  
Pfam View protein in Pfam  
PF14378  PAP2_3  
CDD cd03386  PAP2_Aur1_like  
Amino Acid Sequences AITSSIQRLDLSRDPRKTLRKLRSHKFTLSNSLPYIFMFLPSCYSLWIMSVPILFKLFLPTIYTISILIPITSQFVLPATPIFCWLLTFFSARFIPSSHRPKIHVALLPALESVFYGANISDLQTRYTNSILDVVAWVPYGVMHFALPFVVGFVLWVWGPKGSIQFWGKAFGFMNLLGVLTQLVFPCAAPWYEIIHGLTPASYSMPGSPGGLMRIDRVFHSSGYTNAFGSAPLVFGAFPSLHSGCAVMEALFLSHFFPTPRAIYWGYVGILWWATMYLSHHYLIDLTGGACLSVLVFYLFMP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.59
3 0.67
4 0.7
5 0.73
6 0.75
7 0.77
8 0.82
9 0.86
10 0.88
11 0.85
12 0.83
13 0.81
14 0.75
15 0.74
16 0.69
17 0.64
18 0.55
19 0.5
20 0.42
21 0.33
22 0.32
23 0.22
24 0.2
25 0.16
26 0.14
27 0.16
28 0.17
29 0.17
30 0.14
31 0.15
32 0.12
33 0.12
34 0.12
35 0.1
36 0.1
37 0.11
38 0.11
39 0.11
40 0.12
41 0.11
42 0.11
43 0.14
44 0.13
45 0.13
46 0.15
47 0.15
48 0.16
49 0.16
50 0.16
51 0.13
52 0.12
53 0.14
54 0.11
55 0.1
56 0.08
57 0.08
58 0.1
59 0.1
60 0.09
61 0.07
62 0.07
63 0.07
64 0.07
65 0.09
66 0.08
67 0.08
68 0.09
69 0.1
70 0.1
71 0.1
72 0.11
73 0.11
74 0.11
75 0.12
76 0.1
77 0.13
78 0.14
79 0.13
80 0.13
81 0.13
82 0.17
83 0.25
84 0.33
85 0.35
86 0.37
87 0.4
88 0.43
89 0.47
90 0.47
91 0.4
92 0.33
93 0.32
94 0.29
95 0.27
96 0.22
97 0.18
98 0.12
99 0.09
100 0.08
101 0.05
102 0.04
103 0.04
104 0.04
105 0.05
106 0.05
107 0.06
108 0.08
109 0.09
110 0.1
111 0.11
112 0.12
113 0.13
114 0.14
115 0.13
116 0.1
117 0.12
118 0.1
119 0.09
120 0.09
121 0.07
122 0.07
123 0.06
124 0.06
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.03
131 0.03
132 0.04
133 0.04
134 0.04
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.04
144 0.04
145 0.04
146 0.04
147 0.05
148 0.07
149 0.07
150 0.13
151 0.14
152 0.17
153 0.17
154 0.21
155 0.2
156 0.2
157 0.2
158 0.15
159 0.15
160 0.12
161 0.12
162 0.08
163 0.08
164 0.06
165 0.06
166 0.05
167 0.04
168 0.05
169 0.04
170 0.04
171 0.04
172 0.04
173 0.05
174 0.06
175 0.06
176 0.06
177 0.07
178 0.09
179 0.09
180 0.11
181 0.11
182 0.11
183 0.11
184 0.1
185 0.09
186 0.07
187 0.07
188 0.06
189 0.06
190 0.06
191 0.06
192 0.07
193 0.08
194 0.08
195 0.08
196 0.08
197 0.09
198 0.1
199 0.1
200 0.11
201 0.12
202 0.12
203 0.12
204 0.15
205 0.15
206 0.14
207 0.17
208 0.15
209 0.16
210 0.19
211 0.19
212 0.16
213 0.16
214 0.16
215 0.13
216 0.13
217 0.11
218 0.07
219 0.06
220 0.07
221 0.05
222 0.05
223 0.07
224 0.07
225 0.07
226 0.12
227 0.12
228 0.12
229 0.12
230 0.13
231 0.11
232 0.12
233 0.12
234 0.07
235 0.07
236 0.07
237 0.07
238 0.07
239 0.07
240 0.06
241 0.06
242 0.08
243 0.08
244 0.1
245 0.13
246 0.15
247 0.16
248 0.19
249 0.21
250 0.21
251 0.22
252 0.24
253 0.21
254 0.19
255 0.17
256 0.14
257 0.12
258 0.11
259 0.09
260 0.06
261 0.06
262 0.07
263 0.09
264 0.12
265 0.14
266 0.15
267 0.15
268 0.15
269 0.16
270 0.15
271 0.13
272 0.1
273 0.08
274 0.08
275 0.08
276 0.08
277 0.07
278 0.06
279 0.06
280 0.05
281 0.05
282 0.05