Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S8M3

Protein Details
Accession R7S8M3   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
146-167MCGRCFLKSKSDKKRKFDSVICHydrophilic
NLS Segment(s)
PositionSequence
126-146LKTKTKGEIDGEKRGKRKGKM
Subcellular Location(s) nucl 18, mito 9, cyto_nucl 9
Family & Domain DBs
KEGG tms:TREMEDRAFT_66308  -  
Amino Acid Sequences MRKAANAQVARSRSRLRIIKSAYEEINLEFGRLIACETRNIQPRRLDKVRELAKSEEEQVTAARSNEKGKGTLFTRKGKDIVSPLNFYSIHLCSITDPSELEEEYSVEYEQFKIICHQAGIPIPKLKTKTKGEIDGEKRGKRKGKMCGRCFLKSKSDKKRKFDSVICRRCHDDFTDEDQEDDEEDEEEEEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.49
4 0.54
5 0.56
6 0.59
7 0.6
8 0.61
9 0.52
10 0.47
11 0.43
12 0.34
13 0.35
14 0.26
15 0.2
16 0.15
17 0.14
18 0.12
19 0.11
20 0.12
21 0.09
22 0.1
23 0.13
24 0.16
25 0.23
26 0.32
27 0.35
28 0.39
29 0.44
30 0.49
31 0.55
32 0.58
33 0.56
34 0.51
35 0.58
36 0.6
37 0.56
38 0.54
39 0.47
40 0.45
41 0.42
42 0.41
43 0.33
44 0.25
45 0.21
46 0.18
47 0.17
48 0.15
49 0.14
50 0.13
51 0.13
52 0.15
53 0.19
54 0.2
55 0.19
56 0.18
57 0.22
58 0.23
59 0.3
60 0.33
61 0.36
62 0.38
63 0.38
64 0.39
65 0.35
66 0.35
67 0.31
68 0.33
69 0.28
70 0.28
71 0.26
72 0.27
73 0.27
74 0.24
75 0.23
76 0.16
77 0.14
78 0.12
79 0.12
80 0.09
81 0.11
82 0.12
83 0.09
84 0.08
85 0.08
86 0.09
87 0.09
88 0.08
89 0.07
90 0.06
91 0.06
92 0.07
93 0.06
94 0.05
95 0.06
96 0.06
97 0.07
98 0.06
99 0.06
100 0.08
101 0.09
102 0.09
103 0.09
104 0.09
105 0.11
106 0.15
107 0.17
108 0.18
109 0.21
110 0.21
111 0.24
112 0.28
113 0.29
114 0.34
115 0.37
116 0.43
117 0.44
118 0.51
119 0.52
120 0.58
121 0.59
122 0.61
123 0.62
124 0.59
125 0.57
126 0.57
127 0.59
128 0.57
129 0.59
130 0.59
131 0.63
132 0.69
133 0.71
134 0.73
135 0.73
136 0.72
137 0.71
138 0.65
139 0.65
140 0.64
141 0.69
142 0.71
143 0.75
144 0.77
145 0.79
146 0.84
147 0.83
148 0.81
149 0.79
150 0.79
151 0.79
152 0.8
153 0.77
154 0.71
155 0.67
156 0.61
157 0.56
158 0.48
159 0.41
160 0.38
161 0.41
162 0.46
163 0.41
164 0.39
165 0.36
166 0.33
167 0.29
168 0.25
169 0.17
170 0.09
171 0.09
172 0.1