Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HL33

Protein Details
Accession C6HL33    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
109-148VVHARARRRFNRGLKRKPMGLIKKLRKAKQEAKPNEKPDLBasic
NLS Segment(s)
PositionSequence
113-143RARRRFNRGLKRKPMGLIKKLRKAKQEAKPN
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002222  Ribosomal_S19  
IPR023575  Ribosomal_S19_S15_SF  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00203  Ribosomal_S19  
Amino Acid Sequences METSPNKAELGHKTLAPSLSRASSATLSNSFAGTPNDERLIQRDNIHPSLFERHSESDLRGTFAIMADIEYNADEAAELKKKRAFRKFSYRGIDLNQLLDLSSEQLRDVVHARARRRFNRGLKRKPMGLIKKLRKAKQEAKPNEKPDLVKTHLRDMIVVPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.31
4 0.26
5 0.23
6 0.22
7 0.22
8 0.21
9 0.2
10 0.19
11 0.19
12 0.2
13 0.19
14 0.19
15 0.19
16 0.19
17 0.16
18 0.16
19 0.16
20 0.16
21 0.17
22 0.17
23 0.19
24 0.2
25 0.2
26 0.21
27 0.24
28 0.23
29 0.24
30 0.27
31 0.31
32 0.32
33 0.32
34 0.29
35 0.27
36 0.32
37 0.3
38 0.26
39 0.24
40 0.23
41 0.25
42 0.26
43 0.25
44 0.24
45 0.23
46 0.23
47 0.19
48 0.17
49 0.15
50 0.13
51 0.12
52 0.07
53 0.06
54 0.05
55 0.05
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.03
62 0.04
63 0.06
64 0.11
65 0.11
66 0.13
67 0.16
68 0.22
69 0.3
70 0.38
71 0.43
72 0.45
73 0.56
74 0.62
75 0.67
76 0.67
77 0.62
78 0.55
79 0.51
80 0.49
81 0.38
82 0.31
83 0.23
84 0.17
85 0.15
86 0.13
87 0.11
88 0.07
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07
94 0.09
95 0.11
96 0.13
97 0.17
98 0.22
99 0.27
100 0.34
101 0.43
102 0.47
103 0.52
104 0.58
105 0.63
106 0.7
107 0.76
108 0.79
109 0.8
110 0.8
111 0.77
112 0.73
113 0.73
114 0.71
115 0.69
116 0.7
117 0.69
118 0.73
119 0.78
120 0.78
121 0.76
122 0.76
123 0.77
124 0.76
125 0.77
126 0.78
127 0.79
128 0.83
129 0.8
130 0.77
131 0.72
132 0.65
133 0.6
134 0.58
135 0.53
136 0.52
137 0.5
138 0.52
139 0.51
140 0.49
141 0.43