Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DLW2

Protein Details
Accession A0A0D0DLW2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-46MTIKIPIVKKRTKAFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
9-51KKRTKAFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQLPMP
Subcellular Location(s) mito_nucl 14, nucl 13.5, mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MTIKIPIVKKRTKAFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHLLPNGYKKFLVSNVKEIDILLMHNKSYAAEIAHNVSSRNRTIILERAKVLGVKVTNPAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.86
4 0.88
5 0.87
6 0.86
7 0.84
8 0.83
9 0.79
10 0.73
11 0.64
12 0.6
13 0.59
14 0.59
15 0.61
16 0.61
17 0.59
18 0.57
19 0.58
20 0.61
21 0.63
22 0.64
23 0.64
24 0.66
25 0.71
26 0.78
27 0.83
28 0.76
29 0.73
30 0.71
31 0.67
32 0.67
33 0.64
34 0.64
35 0.63
36 0.65
37 0.59
38 0.52
39 0.46
40 0.37
41 0.37
42 0.33
43 0.35
44 0.4
45 0.41
46 0.42
47 0.45
48 0.47
49 0.47
50 0.46
51 0.47
52 0.46
53 0.55
54 0.57
55 0.55
56 0.51
57 0.43
58 0.39
59 0.36
60 0.35
61 0.26
62 0.3
63 0.29
64 0.3
65 0.3
66 0.28
67 0.23
68 0.15
69 0.14
70 0.1
71 0.09
72 0.09
73 0.09
74 0.09
75 0.09
76 0.09
77 0.1
78 0.08
79 0.09
80 0.1
81 0.13
82 0.14
83 0.15
84 0.15
85 0.17
86 0.19
87 0.19
88 0.2
89 0.19
90 0.18
91 0.21
92 0.29
93 0.33
94 0.33
95 0.33
96 0.33
97 0.32
98 0.31
99 0.29
100 0.26
101 0.2
102 0.18
103 0.21
104 0.25
105 0.26
106 0.27
107 0.31
108 0.28