Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DBI4

Protein Details
Accession A0A0D0DBI4    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
97-116KEQLAKKKSTPKGNKGKEHABasic
NLS Segment(s)
PositionSequence
99-113QLAKKKSTPKGNKGK
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
Amino Acid Sequences SYCSTQSGTKSTGTHNITTQELCNIIGNEYRRRKRESGSDNVNNDMHAGTSVSTTTYYTKDAGHGKKQKVNKGKPKCDNCSWFRHIAADCHRKVGAKEQLAKKKSTPKGNKGKEHANQAHDIKEDKEMDVAFNTTYDVSMNENDNTIDMYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.35
4 0.34
5 0.33
6 0.3
7 0.23
8 0.2
9 0.19
10 0.18
11 0.16
12 0.15
13 0.18
14 0.21
15 0.29
16 0.38
17 0.45
18 0.47
19 0.53
20 0.55
21 0.56
22 0.62
23 0.6
24 0.6
25 0.63
26 0.66
27 0.61
28 0.61
29 0.55
30 0.45
31 0.38
32 0.28
33 0.18
34 0.1
35 0.09
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.07
42 0.08
43 0.09
44 0.1
45 0.11
46 0.11
47 0.14
48 0.21
49 0.25
50 0.32
51 0.39
52 0.41
53 0.46
54 0.51
55 0.56
56 0.58
57 0.64
58 0.65
59 0.68
60 0.74
61 0.78
62 0.8
63 0.78
64 0.74
65 0.72
66 0.65
67 0.63
68 0.57
69 0.5
70 0.43
71 0.4
72 0.35
73 0.33
74 0.38
75 0.38
76 0.35
77 0.35
78 0.35
79 0.32
80 0.32
81 0.36
82 0.34
83 0.31
84 0.39
85 0.46
86 0.54
87 0.56
88 0.57
89 0.53
90 0.55
91 0.57
92 0.59
93 0.6
94 0.62
95 0.7
96 0.78
97 0.81
98 0.76
99 0.79
100 0.73
101 0.74
102 0.7
103 0.62
104 0.6
105 0.53
106 0.51
107 0.43
108 0.4
109 0.31
110 0.31
111 0.28
112 0.22
113 0.23
114 0.2
115 0.2
116 0.19
117 0.19
118 0.13
119 0.12
120 0.13
121 0.1
122 0.1
123 0.09
124 0.08
125 0.1
126 0.13
127 0.15
128 0.15
129 0.16
130 0.16
131 0.16