Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HAB2

Protein Details
Accession C6HAB2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
80-99MIRSNRKKAAKAKAASKKKAHydrophilic
NLS Segment(s)
PositionSequence
84-99NRKKAAKAKAASKKKA
Subcellular Location(s) plas 12, mito 8, E.R. 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MNARSKWQKKTFGRLIGLAMLLVATAVYLYYTAWTLLMPFVDDGHPLHDLFPPRVWAIRIPVILTLLGSAVVGSFLGVVMIRSNRKKAAKAKAASKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.57
3 0.48
4 0.41
5 0.3
6 0.21
7 0.12
8 0.08
9 0.06
10 0.04
11 0.02
12 0.02
13 0.02
14 0.02
15 0.02
16 0.02
17 0.03
18 0.04
19 0.04
20 0.04
21 0.04
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.06
28 0.06
29 0.07
30 0.07
31 0.08
32 0.09
33 0.08
34 0.09
35 0.11
36 0.12
37 0.12
38 0.13
39 0.13
40 0.12
41 0.14
42 0.13
43 0.12
44 0.14
45 0.17
46 0.17
47 0.16
48 0.16
49 0.15
50 0.14
51 0.13
52 0.09
53 0.05
54 0.05
55 0.04
56 0.04
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.02
63 0.03
64 0.03
65 0.03
66 0.06
67 0.1
68 0.17
69 0.2
70 0.24
71 0.32
72 0.37
73 0.44
74 0.51
75 0.58
76 0.62
77 0.65
78 0.72
79 0.76