Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CBZ5

Protein Details
Accession A0A0D0CBZ5   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
28-58GPKTKPVKVTPGKKRPRKRSPRKSPPTGLDFBasic
NLS Segment(s)
PositionSequence
28-51GPKTKPVKVTPGKKRPRKRSPRKS
Subcellular Location(s) nucl 18, cyto 5, mito 3
Family & Domain DBs
Amino Acid Sequences MAKPKHIAFDACSPVIEVKWKTIQTTRGPKTKPVKVTPGKKRPRKRSPRKSPPTGLDFQTYDQGDFHDMPDPLKFPSKTQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.27
4 0.2
5 0.19
6 0.24
7 0.25
8 0.27
9 0.3
10 0.36
11 0.39
12 0.49
13 0.5
14 0.52
15 0.53
16 0.59
17 0.62
18 0.63
19 0.61
20 0.54
21 0.59
22 0.6
23 0.68
24 0.7
25 0.73
26 0.76
27 0.78
28 0.84
29 0.85
30 0.87
31 0.89
32 0.9
33 0.91
34 0.92
35 0.94
36 0.94
37 0.92
38 0.87
39 0.82
40 0.78
41 0.7
42 0.61
43 0.54
44 0.45
45 0.38
46 0.36
47 0.3
48 0.24
49 0.2
50 0.19
51 0.18
52 0.17
53 0.17
54 0.17
55 0.16
56 0.17
57 0.19
58 0.2
59 0.19
60 0.27
61 0.27