Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DLE1

Protein Details
Accession A0A0D0DLE1    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
28-58GPKTKLVKVTPGKKRPRKRSPRKSPPTGPDFBasic
NLS Segment(s)
PositionSequence
29-52PKTKLVKVTPGKKRPRKRSPRKSP
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MAKPKYIAVDAHSPVIEVKWKTIQTTRGPKTKLVKVTPGKKRPRKRSPRKSPPTGPDFQTYNQGVFYDMPDPLKFPSKTQNDFLREWQDHKDYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.25
4 0.17
5 0.19
6 0.22
7 0.23
8 0.26
9 0.3
10 0.35
11 0.38
12 0.49
13 0.52
14 0.53
15 0.54
16 0.57
17 0.59
18 0.59
19 0.58
20 0.5
21 0.53
22 0.54
23 0.62
24 0.67
25 0.69
26 0.73
27 0.75
28 0.83
29 0.84
30 0.87
31 0.89
32 0.9
33 0.92
34 0.93
35 0.94
36 0.93
37 0.91
38 0.88
39 0.84
40 0.79
41 0.72
42 0.63
43 0.56
44 0.49
45 0.41
46 0.4
47 0.33
48 0.27
49 0.23
50 0.2
51 0.17
52 0.15
53 0.16
54 0.11
55 0.11
56 0.13
57 0.12
58 0.13
59 0.14
60 0.22
61 0.21
62 0.22
63 0.31
64 0.37
65 0.42
66 0.48
67 0.55
68 0.52
69 0.54
70 0.57
71 0.57
72 0.52
73 0.51
74 0.5