Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DDW7

Protein Details
Accession A0A0D0DDW7   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
57-82LEPFFIRKFKKPQCFKKQALEQRRFYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004875  DDE_SF_endonuclease_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF03184  DDE_1  
Amino Acid Sequences ILAKFQPRDRVDFNKTGFFPYAPPDGGLASKQMSSKKKDKFRISIGFVCNADGSEKLEPFFIRKFKKPQCFKKQALEQRRFYYCNNKGHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.52
3 0.49
4 0.44
5 0.36
6 0.3
7 0.26
8 0.27
9 0.2
10 0.2
11 0.17
12 0.16
13 0.16
14 0.15
15 0.13
16 0.1
17 0.11
18 0.13
19 0.19
20 0.23
21 0.28
22 0.36
23 0.43
24 0.52
25 0.59
26 0.64
27 0.63
28 0.66
29 0.67
30 0.64
31 0.61
32 0.53
33 0.47
34 0.4
35 0.35
36 0.27
37 0.19
38 0.15
39 0.1
40 0.11
41 0.1
42 0.1
43 0.1
44 0.11
45 0.11
46 0.14
47 0.18
48 0.23
49 0.27
50 0.33
51 0.43
52 0.51
53 0.62
54 0.69
55 0.76
56 0.8
57 0.84
58 0.83
59 0.83
60 0.84
61 0.84
62 0.85
63 0.83
64 0.78
65 0.76
66 0.76
67 0.69
68 0.63
69 0.63
70 0.6