Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CE08

Protein Details
Accession A0A0D0CE08    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-35RVASDGEKGKKKKEKKKKKKRKEMLAKGSNRGBasic
NLS Segment(s)
PositionSequence
11-30KGKKKKEKKKKKKRKEMLAK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MVNRVASDGEKGKKKKEKKKKKKRKEMLAKGSNRGQESGAAGSQLGGPIGPKLGEKAEEKVADPLLLPAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.71
3 0.76
4 0.8
5 0.83
6 0.92
7 0.94
8 0.96
9 0.97
10 0.96
11 0.96
12 0.96
13 0.96
14 0.95
15 0.93
16 0.86
17 0.78
18 0.72
19 0.64
20 0.53
21 0.43
22 0.32
23 0.23
24 0.2
25 0.17
26 0.13
27 0.09
28 0.08
29 0.08
30 0.07
31 0.06
32 0.05
33 0.04
34 0.04
35 0.04
36 0.05
37 0.05
38 0.05
39 0.07
40 0.08
41 0.12
42 0.14
43 0.18
44 0.23
45 0.24
46 0.26
47 0.27
48 0.27
49 0.23
50 0.21