Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6H262

Protein Details
Accession C6H262    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-26HDYLERRRIRRNGNRRVLDEBasic
62-86VQPTVPTKSKKSRKNKRAVTEELVPHydrophilic
NLS Segment(s)
PositionSequence
70-78SKKSRKNKR
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 3
Family & Domain DBs
Amino Acid Sequences MPLAWLHDYLERRRIRRNGNRRVLDERFGDPDITAPMAETEKTPLEPVNERHHTPVPVPVPVQPTVPTKSKKSRKNKRAVTEELVPSDEDLFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.6
3 0.67
4 0.73
5 0.75
6 0.8
7 0.83
8 0.78
9 0.79
10 0.71
11 0.64
12 0.57
13 0.48
14 0.41
15 0.35
16 0.31
17 0.23
18 0.2
19 0.17
20 0.14
21 0.11
22 0.07
23 0.07
24 0.08
25 0.08
26 0.07
27 0.08
28 0.08
29 0.09
30 0.09
31 0.09
32 0.11
33 0.14
34 0.18
35 0.24
36 0.27
37 0.27
38 0.3
39 0.32
40 0.31
41 0.28
42 0.31
43 0.24
44 0.23
45 0.23
46 0.22
47 0.23
48 0.23
49 0.24
50 0.2
51 0.22
52 0.24
53 0.3
54 0.31
55 0.35
56 0.45
57 0.53
58 0.6
59 0.68
60 0.75
61 0.79
62 0.86
63 0.89
64 0.88
65 0.88
66 0.85
67 0.8
68 0.77
69 0.71
70 0.62
71 0.53
72 0.44
73 0.36