Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DYY8

Protein Details
Accession A0A0D0DYY8    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
49-72SNSDLGPTKKKKKWKTGKVNAVSMHydrophilic
NLS Segment(s)
PositionSequence
57-64KKKKKWKT
Subcellular Location(s) nucl 18.5, mito_nucl 11, cyto 4, mito 2.5, cyto_pero 2.5
Family & Domain DBs
Amino Acid Sequences NRYDINDQIEDGEAFDGWGGAHQRWMEYTKKALGDSDSNEEESPTNTNSNSDLGPTKKKKKWKTGKVNAVSMVSHIGNAWIVDIKDASLDVMKPMVQGFITFHYRWASGMKDGSVPWMQISTQRSNYISGKYLPQGAKLWEPSKLQKKEVISFLEFWREKQKSDPTNVFNFRKWRDSTGTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.05
5 0.08
6 0.1
7 0.09
8 0.13
9 0.13
10 0.14
11 0.16
12 0.2
13 0.2
14 0.21
15 0.25
16 0.27
17 0.29
18 0.29
19 0.28
20 0.28
21 0.28
22 0.29
23 0.31
24 0.27
25 0.27
26 0.26
27 0.25
28 0.22
29 0.19
30 0.18
31 0.14
32 0.14
33 0.13
34 0.14
35 0.14
36 0.15
37 0.14
38 0.13
39 0.16
40 0.18
41 0.28
42 0.35
43 0.44
44 0.48
45 0.57
46 0.65
47 0.72
48 0.79
49 0.81
50 0.84
51 0.85
52 0.9
53 0.86
54 0.8
55 0.71
56 0.61
57 0.49
58 0.38
59 0.3
60 0.19
61 0.13
62 0.09
63 0.08
64 0.06
65 0.06
66 0.06
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.05
83 0.04
84 0.05
85 0.06
86 0.09
87 0.13
88 0.13
89 0.14
90 0.15
91 0.15
92 0.15
93 0.16
94 0.14
95 0.12
96 0.13
97 0.12
98 0.13
99 0.12
100 0.16
101 0.15
102 0.13
103 0.11
104 0.11
105 0.1
106 0.14
107 0.19
108 0.2
109 0.22
110 0.24
111 0.25
112 0.28
113 0.3
114 0.28
115 0.26
116 0.23
117 0.23
118 0.22
119 0.28
120 0.25
121 0.25
122 0.25
123 0.25
124 0.28
125 0.31
126 0.31
127 0.29
128 0.32
129 0.38
130 0.46
131 0.47
132 0.46
133 0.46
134 0.49
135 0.5
136 0.52
137 0.49
138 0.41
139 0.4
140 0.39
141 0.44
142 0.39
143 0.36
144 0.41
145 0.37
146 0.35
147 0.4
148 0.48
149 0.45
150 0.54
151 0.6
152 0.56
153 0.64
154 0.72
155 0.68
156 0.64
157 0.66
158 0.62
159 0.61
160 0.59
161 0.55