Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DKC5

Protein Details
Accession A0A0D0DKC5   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
149-177NSITKGKQHAKSKTPKKPCSKMQLSPSCAHydrophilic
NLS Segment(s)
PositionSequence
159-159K
Subcellular Location(s) nucl 16.5, mito_nucl 12.166, cyto_nucl 11.333, mito 6.5
Family & Domain DBs
Amino Acid Sequences MAYKFLNTITLQLPLKYPEPFCMTYEPDFPGKLTIEILPAVVESPIKRKQNLPITVPQGTVLHSVPLGNSLTATYPIPKKQRVIGKYILLATESESMPPTPRVKLLDVVVLSSSKAKKELALDSTCKRKQRSPTGQLLSPSKHPKLFGNSITKGKQHAKSKTPKKPCSKMQLSPSCASLSSFTYTKPIASGSWYYGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.27
4 0.27
5 0.26
6 0.31
7 0.32
8 0.32
9 0.34
10 0.35
11 0.34
12 0.36
13 0.33
14 0.29
15 0.28
16 0.26
17 0.24
18 0.21
19 0.19
20 0.17
21 0.15
22 0.14
23 0.14
24 0.13
25 0.1
26 0.09
27 0.08
28 0.07
29 0.08
30 0.07
31 0.13
32 0.21
33 0.25
34 0.26
35 0.29
36 0.38
37 0.47
38 0.51
39 0.5
40 0.5
41 0.52
42 0.52
43 0.49
44 0.41
45 0.31
46 0.27
47 0.24
48 0.17
49 0.12
50 0.1
51 0.1
52 0.09
53 0.1
54 0.1
55 0.07
56 0.07
57 0.07
58 0.07
59 0.08
60 0.09
61 0.1
62 0.13
63 0.19
64 0.24
65 0.26
66 0.27
67 0.32
68 0.4
69 0.39
70 0.41
71 0.4
72 0.37
73 0.36
74 0.35
75 0.29
76 0.21
77 0.19
78 0.15
79 0.13
80 0.1
81 0.09
82 0.09
83 0.09
84 0.1
85 0.12
86 0.12
87 0.11
88 0.13
89 0.14
90 0.15
91 0.17
92 0.17
93 0.17
94 0.16
95 0.15
96 0.14
97 0.12
98 0.11
99 0.12
100 0.12
101 0.09
102 0.11
103 0.11
104 0.12
105 0.15
106 0.19
107 0.21
108 0.24
109 0.27
110 0.29
111 0.39
112 0.41
113 0.43
114 0.42
115 0.43
116 0.49
117 0.56
118 0.63
119 0.62
120 0.68
121 0.67
122 0.67
123 0.65
124 0.6
125 0.51
126 0.48
127 0.47
128 0.4
129 0.38
130 0.36
131 0.37
132 0.4
133 0.44
134 0.43
135 0.45
136 0.46
137 0.5
138 0.51
139 0.48
140 0.46
141 0.48
142 0.49
143 0.5
144 0.54
145 0.57
146 0.65
147 0.75
148 0.79
149 0.82
150 0.84
151 0.86
152 0.87
153 0.87
154 0.87
155 0.84
156 0.82
157 0.82
158 0.82
159 0.78
160 0.7
161 0.63
162 0.53
163 0.45
164 0.38
165 0.3
166 0.23
167 0.21
168 0.2
169 0.18
170 0.21
171 0.21
172 0.2
173 0.19
174 0.18
175 0.14
176 0.19
177 0.21
178 0.22