Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CST0

Protein Details
Accession A0A0D0CST0    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
175-208KEKEKDKDKEQERRERRERRREKAEDKERRRLKABasic
220-248GDMETQKQERREKKKERKKAEERRRMEAEBasic
NLS Segment(s)
PositionSequence
168-217RVDKGKGKEKEKDKDKEQERRERRERRREKAEDKERRRLKADAQPKERKL
225-244QKQERREKKKERKKAEERRR
Subcellular Location(s) extr 5, mito 4.5, cyto_mito 4.333, plas 4, E.R. 4, cyto_nucl 3.833, nucl 3.5, cyto 3, golg 3
Family & Domain DBs
Amino Acid Sequences MVSRILTTVAARFLQWMQVMLVIVIEQLVMGCVALGENITPDTRIPYFNYYLATEFVVGCHNPTSIDAWRRKPENEDLDLEQIHPDTLDWAAYNATLGKHLSGAYYKYSLANVRVRASWIQLLDALVNAEPAKLVHGMVGLGYQLRKDVNEDRDAEGVIDDNTADIRRVDKGKGKEKEKDKDKEQERRERRERRREKAEDKERRRLKADAQPKERKLTVGDMETQKQERREKKKERKKAEERRRMEAEAEADAQAAANAAAGSKEESEQGMDVADVDAVSEDLVDRECDVTMQGVSCALTICSSHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.18
4 0.15
5 0.16
6 0.16
7 0.14
8 0.13
9 0.09
10 0.08
11 0.06
12 0.05
13 0.03
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.04
23 0.03
24 0.04
25 0.06
26 0.07
27 0.07
28 0.08
29 0.12
30 0.13
31 0.15
32 0.18
33 0.22
34 0.25
35 0.26
36 0.28
37 0.25
38 0.25
39 0.24
40 0.21
41 0.17
42 0.14
43 0.13
44 0.13
45 0.12
46 0.11
47 0.12
48 0.11
49 0.1
50 0.12
51 0.15
52 0.18
53 0.27
54 0.32
55 0.38
56 0.45
57 0.48
58 0.49
59 0.51
60 0.54
61 0.52
62 0.5
63 0.47
64 0.42
65 0.42
66 0.4
67 0.35
68 0.27
69 0.2
70 0.15
71 0.11
72 0.09
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.07
82 0.07
83 0.07
84 0.08
85 0.07
86 0.08
87 0.08
88 0.09
89 0.09
90 0.11
91 0.11
92 0.12
93 0.13
94 0.13
95 0.14
96 0.15
97 0.18
98 0.22
99 0.22
100 0.23
101 0.23
102 0.24
103 0.23
104 0.23
105 0.21
106 0.16
107 0.14
108 0.13
109 0.13
110 0.11
111 0.1
112 0.08
113 0.06
114 0.06
115 0.05
116 0.05
117 0.04
118 0.04
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.04
128 0.04
129 0.04
130 0.04
131 0.05
132 0.05
133 0.05
134 0.08
135 0.14
136 0.17
137 0.21
138 0.23
139 0.24
140 0.24
141 0.24
142 0.21
143 0.15
144 0.12
145 0.08
146 0.06
147 0.04
148 0.04
149 0.04
150 0.04
151 0.05
152 0.04
153 0.05
154 0.08
155 0.1
156 0.13
157 0.19
158 0.26
159 0.36
160 0.43
161 0.47
162 0.52
163 0.59
164 0.66
165 0.69
166 0.68
167 0.64
168 0.66
169 0.7
170 0.72
171 0.72
172 0.73
173 0.72
174 0.76
175 0.8
176 0.82
177 0.84
178 0.85
179 0.87
180 0.85
181 0.88
182 0.87
183 0.85
184 0.86
185 0.86
186 0.86
187 0.84
188 0.85
189 0.8
190 0.75
191 0.7
192 0.62
193 0.58
194 0.57
195 0.59
196 0.59
197 0.63
198 0.68
199 0.67
200 0.69
201 0.62
202 0.54
203 0.46
204 0.42
205 0.36
206 0.29
207 0.33
208 0.31
209 0.33
210 0.35
211 0.35
212 0.33
213 0.36
214 0.42
215 0.46
216 0.52
217 0.61
218 0.69
219 0.77
220 0.85
221 0.89
222 0.91
223 0.92
224 0.94
225 0.94
226 0.94
227 0.94
228 0.88
229 0.85
230 0.8
231 0.71
232 0.61
233 0.53
234 0.44
235 0.36
236 0.33
237 0.24
238 0.19
239 0.17
240 0.15
241 0.1
242 0.08
243 0.05
244 0.04
245 0.04
246 0.04
247 0.04
248 0.05
249 0.06
250 0.07
251 0.08
252 0.08
253 0.09
254 0.1
255 0.11
256 0.1
257 0.09
258 0.08
259 0.08
260 0.07
261 0.07
262 0.05
263 0.05
264 0.05
265 0.05
266 0.05
267 0.04
268 0.04
269 0.05
270 0.06
271 0.06
272 0.07
273 0.08
274 0.08
275 0.09
276 0.09
277 0.1
278 0.1
279 0.1
280 0.1
281 0.1
282 0.1
283 0.1
284 0.1
285 0.09
286 0.09