Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CVF8

Protein Details
Accession A0A0D0CVF8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
50-71LLWSRAKRTRGRGRPRACRGIVHydrophilic
NLS Segment(s)
PositionSequence
54-65RAKRTRGRGRPR
Subcellular Location(s) mito 18.5, cyto_mito 13, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MYLKPSSFTRGSESDFAVGLALTRHSMVSTTKQAAEVAYTRVARNGRNALLWSRAKRTRGRGRPRACRGIVPFFVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.23
4 0.17
5 0.14
6 0.1
7 0.07
8 0.06
9 0.06
10 0.06
11 0.06
12 0.06
13 0.07
14 0.08
15 0.13
16 0.16
17 0.18
18 0.18
19 0.18
20 0.18
21 0.17
22 0.17
23 0.14
24 0.11
25 0.12
26 0.13
27 0.12
28 0.15
29 0.17
30 0.16
31 0.2
32 0.22
33 0.2
34 0.2
35 0.22
36 0.21
37 0.27
38 0.31
39 0.29
40 0.33
41 0.38
42 0.41
43 0.46
44 0.55
45 0.58
46 0.64
47 0.72
48 0.75
49 0.8
50 0.86
51 0.88
52 0.88
53 0.79
54 0.76
55 0.72
56 0.7