Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HQU9

Protein Details
Accession C6HQU9    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
14-55GTPVSTRHQHQHPHQHQHQQHQQRQHQHQQHQHQQHQHQQQQHydrophilic
380-408MQAPPPQKQQKQHQKQQKQQQQQQKNLPGHydrophilic
NLS Segment(s)
PositionSequence
316-325KQGKRGRKRK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MFNWHTSVEPPPQGTPVSTRHQHQHPHQHQHQQHQQRQHQHQQHQHQQHQHQQQQHQHQQHQQHQQHQQHQQQQQQQQSHHSSLQWLPAAPPLSRPLPNTLPPISALRPANNFASNAQHDSAILQTPASTDPSLSESPSVRENAAAESAVDLSPEPAYDHPAPGPEPSSDDADGVEGGSISRQQAGRVGPGRGVDLALLENETPRKHGKRLTTREETALFEICNRHAASFGERNRLCEWWVNVTQEFTASEGHPYSWHSVRRKVELVTQQRIKFLAGLDGKRRDDQADAAWSAAVDSWIPSWKRFQEQENERINAKQGKRGRKRKSVFDTEGVGLGYQHMLPPGFETMFPPSSKPSKPSRMDAPAALPATTAPSTTAEPMQAPPPQKQQKQHQKQQKQQQQQQKNLPGSIPVQPTPQQTTMPNTAPIMTAATSSSSSSGAVAAAEPDVGAAILETLSKLNKNLEAVSSRSHQSNAMSLAAAAAAAAGGAHPLQHQHQHQHQQQNPSQNPTMTNQPHASHSRTAATAAATGAPAAAPPPVQTQIPASTLHQLKSELRAELRQEIQKDRAQLEEKLDTVQRTQEMILELLRQEPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.31
4 0.36
5 0.38
6 0.41
7 0.46
8 0.53
9 0.6
10 0.65
11 0.7
12 0.71
13 0.77
14 0.8
15 0.83
16 0.82
17 0.83
18 0.83
19 0.83
20 0.8
21 0.8
22 0.81
23 0.8
24 0.84
25 0.84
26 0.83
27 0.82
28 0.85
29 0.85
30 0.87
31 0.87
32 0.85
33 0.84
34 0.82
35 0.83
36 0.83
37 0.79
38 0.77
39 0.76
40 0.77
41 0.78
42 0.8
43 0.78
44 0.75
45 0.76
46 0.77
47 0.78
48 0.79
49 0.75
50 0.75
51 0.76
52 0.78
53 0.8
54 0.8
55 0.79
56 0.78
57 0.78
58 0.77
59 0.76
60 0.75
61 0.74
62 0.71
63 0.65
64 0.64
65 0.63
66 0.59
67 0.52
68 0.46
69 0.42
70 0.38
71 0.41
72 0.34
73 0.28
74 0.25
75 0.27
76 0.29
77 0.24
78 0.25
79 0.23
80 0.26
81 0.29
82 0.3
83 0.32
84 0.35
85 0.4
86 0.42
87 0.4
88 0.36
89 0.35
90 0.37
91 0.32
92 0.33
93 0.31
94 0.29
95 0.3
96 0.32
97 0.34
98 0.31
99 0.3
100 0.25
101 0.3
102 0.28
103 0.28
104 0.26
105 0.23
106 0.21
107 0.21
108 0.21
109 0.16
110 0.13
111 0.09
112 0.09
113 0.1
114 0.11
115 0.13
116 0.12
117 0.1
118 0.11
119 0.16
120 0.17
121 0.16
122 0.17
123 0.16
124 0.17
125 0.21
126 0.21
127 0.16
128 0.16
129 0.16
130 0.15
131 0.15
132 0.14
133 0.11
134 0.1
135 0.11
136 0.1
137 0.09
138 0.07
139 0.07
140 0.07
141 0.07
142 0.08
143 0.07
144 0.13
145 0.14
146 0.15
147 0.15
148 0.17
149 0.18
150 0.17
151 0.19
152 0.13
153 0.16
154 0.16
155 0.19
156 0.17
157 0.16
158 0.15
159 0.14
160 0.13
161 0.1
162 0.08
163 0.05
164 0.04
165 0.04
166 0.05
167 0.05
168 0.08
169 0.09
170 0.09
171 0.13
172 0.14
173 0.2
174 0.23
175 0.23
176 0.22
177 0.22
178 0.23
179 0.19
180 0.18
181 0.11
182 0.08
183 0.08
184 0.07
185 0.07
186 0.06
187 0.07
188 0.09
189 0.09
190 0.11
191 0.17
192 0.2
193 0.23
194 0.29
195 0.38
196 0.47
197 0.55
198 0.61
199 0.63
200 0.61
201 0.61
202 0.57
203 0.49
204 0.4
205 0.32
206 0.23
207 0.18
208 0.18
209 0.15
210 0.17
211 0.15
212 0.13
213 0.13
214 0.14
215 0.17
216 0.24
217 0.26
218 0.32
219 0.32
220 0.35
221 0.36
222 0.35
223 0.31
224 0.28
225 0.27
226 0.23
227 0.26
228 0.25
229 0.24
230 0.24
231 0.22
232 0.18
233 0.17
234 0.11
235 0.1
236 0.08
237 0.09
238 0.09
239 0.09
240 0.09
241 0.11
242 0.13
243 0.16
244 0.22
245 0.24
246 0.31
247 0.34
248 0.38
249 0.39
250 0.36
251 0.39
252 0.41
253 0.45
254 0.45
255 0.49
256 0.46
257 0.44
258 0.43
259 0.37
260 0.29
261 0.22
262 0.21
263 0.18
264 0.2
265 0.24
266 0.28
267 0.29
268 0.29
269 0.3
270 0.24
271 0.21
272 0.2
273 0.17
274 0.16
275 0.15
276 0.14
277 0.13
278 0.12
279 0.11
280 0.09
281 0.07
282 0.03
283 0.03
284 0.04
285 0.08
286 0.09
287 0.1
288 0.13
289 0.15
290 0.2
291 0.22
292 0.25
293 0.31
294 0.36
295 0.45
296 0.48
297 0.48
298 0.44
299 0.42
300 0.41
301 0.38
302 0.33
303 0.31
304 0.32
305 0.41
306 0.51
307 0.61
308 0.67
309 0.7
310 0.74
311 0.77
312 0.78
313 0.77
314 0.7
315 0.63
316 0.57
317 0.47
318 0.44
319 0.33
320 0.25
321 0.15
322 0.11
323 0.09
324 0.05
325 0.05
326 0.05
327 0.05
328 0.05
329 0.06
330 0.07
331 0.07
332 0.08
333 0.09
334 0.12
335 0.15
336 0.15
337 0.15
338 0.17
339 0.22
340 0.23
341 0.27
342 0.31
343 0.38
344 0.41
345 0.45
346 0.49
347 0.49
348 0.5
349 0.46
350 0.4
351 0.35
352 0.32
353 0.28
354 0.2
355 0.14
356 0.15
357 0.14
358 0.12
359 0.08
360 0.09
361 0.1
362 0.11
363 0.12
364 0.1
365 0.11
366 0.12
367 0.14
368 0.17
369 0.18
370 0.2
371 0.3
372 0.38
373 0.43
374 0.49
375 0.57
376 0.65
377 0.73
378 0.79
379 0.8
380 0.81
381 0.85
382 0.88
383 0.87
384 0.86
385 0.84
386 0.86
387 0.84
388 0.82
389 0.83
390 0.8
391 0.73
392 0.64
393 0.55
394 0.47
395 0.4
396 0.37
397 0.32
398 0.25
399 0.25
400 0.27
401 0.3
402 0.32
403 0.32
404 0.28
405 0.26
406 0.31
407 0.33
408 0.31
409 0.29
410 0.25
411 0.24
412 0.22
413 0.2
414 0.16
415 0.11
416 0.1
417 0.08
418 0.09
419 0.09
420 0.09
421 0.1
422 0.09
423 0.08
424 0.08
425 0.08
426 0.07
427 0.06
428 0.06
429 0.06
430 0.05
431 0.05
432 0.04
433 0.04
434 0.04
435 0.03
436 0.03
437 0.02
438 0.03
439 0.03
440 0.03
441 0.04
442 0.05
443 0.06
444 0.07
445 0.09
446 0.11
447 0.13
448 0.15
449 0.16
450 0.19
451 0.2
452 0.21
453 0.24
454 0.24
455 0.24
456 0.24
457 0.24
458 0.22
459 0.21
460 0.23
461 0.22
462 0.19
463 0.17
464 0.16
465 0.15
466 0.13
467 0.11
468 0.07
469 0.04
470 0.03
471 0.02
472 0.02
473 0.02
474 0.03
475 0.03
476 0.03
477 0.04
478 0.06
479 0.09
480 0.17
481 0.21
482 0.28
483 0.37
484 0.47
485 0.54
486 0.63
487 0.65
488 0.68
489 0.69
490 0.72
491 0.68
492 0.65
493 0.6
494 0.52
495 0.49
496 0.42
497 0.48
498 0.4
499 0.42
500 0.39
501 0.37
502 0.42
503 0.44
504 0.45
505 0.39
506 0.39
507 0.36
508 0.32
509 0.32
510 0.27
511 0.23
512 0.2
513 0.16
514 0.14
515 0.11
516 0.1
517 0.09
518 0.07
519 0.06
520 0.06
521 0.06
522 0.06
523 0.07
524 0.12
525 0.14
526 0.14
527 0.16
528 0.19
529 0.22
530 0.23
531 0.23
532 0.21
533 0.28
534 0.31
535 0.31
536 0.3
537 0.3
538 0.3
539 0.36
540 0.38
541 0.33
542 0.33
543 0.36
544 0.38
545 0.41
546 0.45
547 0.44
548 0.45
549 0.47
550 0.5
551 0.48
552 0.5
553 0.44
554 0.45
555 0.44
556 0.43
557 0.44
558 0.42
559 0.39
560 0.38
561 0.4
562 0.34
563 0.32
564 0.33
565 0.29
566 0.26
567 0.26
568 0.25
569 0.24
570 0.23
571 0.23
572 0.21
573 0.19