Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CVE5

Protein Details
Accession A0A0D0CVE5   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-27RTLKRSGFTRKKLTRPAIKRNEARRAAHydrophilic
NLS Segment(s)
PositionSequence
10-20RKKLTRPAIKR
Subcellular Location(s) mito 13, nucl 8, cyto 6
Family & Domain DBs
Amino Acid Sequences RTLKRSGFTRKKLTRPAIKRNEARRAAYTLHMGQSYEPHQLVFVDESHLNRLTTRRPSGWARMERCARRRELFIRGQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.85
4 0.84
5 0.85
6 0.84
7 0.83
8 0.83
9 0.78
10 0.72
11 0.64
12 0.57
13 0.49
14 0.43
15 0.38
16 0.29
17 0.26
18 0.22
19 0.2
20 0.16
21 0.17
22 0.16
23 0.15
24 0.13
25 0.11
26 0.11
27 0.11
28 0.12
29 0.1
30 0.08
31 0.08
32 0.09
33 0.1
34 0.13
35 0.14
36 0.13
37 0.14
38 0.16
39 0.19
40 0.26
41 0.29
42 0.28
43 0.32
44 0.37
45 0.44
46 0.51
47 0.54
48 0.52
49 0.56
50 0.64
51 0.68
52 0.7
53 0.68
54 0.66
55 0.61
56 0.65
57 0.61
58 0.61