Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0E648

Protein Details
Accession A0A0D0E648   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-62CFGPRENRERLRPWKKKSREVMEAEEQAKKGRRNEKRKARRHRTPKVAGVQBasic
NLS Segment(s)
PositionSequence
19-57RERLRPWKKKSREVMEAEEQAKKGRRNEKRKARRHRTPK
Subcellular Location(s) nucl 18.5, cyto_nucl 13.166, mito_nucl 12.499, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MDYGEKCVDYFCFGPRENRERLRPWKKKSREVMEAEEQAKKGRRNEKRKARRHRTPKVAGVQNAIINVLSCSCRNRTSNSADNLTVRLVRSGMWARIAMGWKRKSSSCSMVVTRLINHMGSMCP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.39
3 0.44
4 0.48
5 0.54
6 0.57
7 0.6
8 0.7
9 0.73
10 0.75
11 0.78
12 0.81
13 0.82
14 0.85
15 0.86
16 0.84
17 0.81
18 0.77
19 0.75
20 0.7
21 0.67
22 0.59
23 0.52
24 0.43
25 0.38
26 0.38
27 0.35
28 0.35
29 0.4
30 0.48
31 0.56
32 0.66
33 0.74
34 0.79
35 0.85
36 0.9
37 0.9
38 0.9
39 0.91
40 0.9
41 0.89
42 0.85
43 0.82
44 0.79
45 0.73
46 0.64
47 0.55
48 0.47
49 0.37
50 0.3
51 0.23
52 0.14
53 0.09
54 0.08
55 0.07
56 0.06
57 0.06
58 0.08
59 0.11
60 0.15
61 0.16
62 0.21
63 0.25
64 0.31
65 0.38
66 0.4
67 0.41
68 0.38
69 0.37
70 0.34
71 0.29
72 0.24
73 0.17
74 0.14
75 0.11
76 0.1
77 0.15
78 0.17
79 0.17
80 0.18
81 0.17
82 0.18
83 0.21
84 0.26
85 0.25
86 0.31
87 0.34
88 0.35
89 0.38
90 0.4
91 0.41
92 0.42
93 0.45
94 0.41
95 0.43
96 0.43
97 0.44
98 0.45
99 0.43
100 0.38
101 0.35
102 0.31
103 0.25
104 0.23