Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CLN7

Protein Details
Accession A0A0D0CLN7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
67-88HGKQQHECKRPYRSDKRLRRRSBasic
NLS Segment(s)
PositionSequence
82-88KRLRRRS
Subcellular Location(s) extr 20, mito 3, E.R. 2
Family & Domain DBs
Amino Acid Sequences MRLATSAIVASLAVLAVGASNPWPNYDLHARGQSESCGFKGDTCDPLKSLSCCPHLVCRAENNGMMHGKQQHECKRPYRSDKRLRRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.04
7 0.06
8 0.06
9 0.07
10 0.09
11 0.09
12 0.13
13 0.18
14 0.21
15 0.23
16 0.28
17 0.28
18 0.28
19 0.28
20 0.25
21 0.22
22 0.21
23 0.17
24 0.14
25 0.13
26 0.13
27 0.16
28 0.16
29 0.19
30 0.2
31 0.2
32 0.18
33 0.2
34 0.21
35 0.19
36 0.21
37 0.2
38 0.21
39 0.22
40 0.23
41 0.27
42 0.3
43 0.31
44 0.3
45 0.29
46 0.31
47 0.32
48 0.34
49 0.28
50 0.28
51 0.27
52 0.25
53 0.24
54 0.24
55 0.26
56 0.27
57 0.36
58 0.41
59 0.48
60 0.54
61 0.58
62 0.63
63 0.7
64 0.76
65 0.78
66 0.8
67 0.83
68 0.88