Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0E414

Protein Details
Accession A0A0D0E414    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-39APECHPTARPTPHRRPQRRYDATTRRIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 14.5, cyto 10
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHSCPILQRGSEAPECHPTARPTPHRRPQRRYDATTRRIIYHVWVSVFHPVTITTFLARRLVYRCRNLSRVNRIFYSPIRSPLSPLSQHSTPNLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.33
4 0.34
5 0.32
6 0.35
7 0.43
8 0.5
9 0.53
10 0.61
11 0.69
12 0.76
13 0.83
14 0.83
15 0.84
16 0.85
17 0.84
18 0.8
19 0.81
20 0.8
21 0.76
22 0.76
23 0.68
24 0.58
25 0.5
26 0.44
27 0.36
28 0.29
29 0.25
30 0.17
31 0.17
32 0.15
33 0.19
34 0.19
35 0.16
36 0.13
37 0.11
38 0.11
39 0.12
40 0.12
41 0.08
42 0.09
43 0.1
44 0.12
45 0.12
46 0.13
47 0.15
48 0.24
49 0.3
50 0.36
51 0.42
52 0.45
53 0.5
54 0.56
55 0.61
56 0.64
57 0.64
58 0.61
59 0.56
60 0.53
61 0.52
62 0.47
63 0.46
64 0.38
65 0.38
66 0.39
67 0.37
68 0.38
69 0.4
70 0.44
71 0.4
72 0.41
73 0.42
74 0.39
75 0.41