Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DR63

Protein Details
Accession A0A0D0DR63    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
18-47SGKHPGRNWHRRYLKRYKKTIKMAKPRHLDBasic
NLS Segment(s)
PositionSequence
20-49KHPGRNWHRRYLKRYKKTIKMAKPRHLDPK
Subcellular Location(s) nucl 13.5, mito_nucl 12.166, cyto_nucl 9.833, mito 9.5
Family & Domain DBs
Amino Acid Sequences MAAPLHPRDLRARAYDISGKHPGRNWHRRYLKRYKKTIKMAKPRHLDPKRAQNFNRTNVEGYLPTSAKMTLLRLLTRSRYQWRVQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.35
4 0.36
5 0.41
6 0.38
7 0.36
8 0.39
9 0.44
10 0.49
11 0.58
12 0.57
13 0.59
14 0.67
15 0.73
16 0.78
17 0.8
18 0.8
19 0.79
20 0.85
21 0.83
22 0.83
23 0.85
24 0.86
25 0.84
26 0.84
27 0.84
28 0.82
29 0.78
30 0.73
31 0.74
32 0.68
33 0.66
34 0.6
35 0.63
36 0.61
37 0.63
38 0.6
39 0.59
40 0.61
41 0.61
42 0.61
43 0.52
44 0.46
45 0.4
46 0.4
47 0.31
48 0.26
49 0.23
50 0.18
51 0.16
52 0.15
53 0.15
54 0.14
55 0.14
56 0.15
57 0.14
58 0.17
59 0.18
60 0.2
61 0.25
62 0.3
63 0.34
64 0.39
65 0.42
66 0.46