Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HKY0

Protein Details
Accession C6HKY0    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
50-74SADGQQRMVRKRRRKPAEPRLHGESBasic
NLS Segment(s)
PositionSequence
59-67RKRRRKPAE
Subcellular Location(s) plas 7extr 7, mito 4, E.R. 3, golg 3, nucl 1.5, cyto_nucl 1.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPSYLHPRSRSTVSLFTITLMSSLVIVGIPHLFPCPVPRHAYADSEMIMSADGQQRMVRKRRRKPAEPRLHGESDANSALIDDTTTQIHTVTPKNLIHRQQEGTVDEEIVKFRQMEEEARNLATVKRECPVPKPGGVIGQLLGFRSQDAGSGRDGIPRADIPGRGSGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.38
3 0.34
4 0.3
5 0.25
6 0.2
7 0.13
8 0.1
9 0.07
10 0.06
11 0.05
12 0.05
13 0.04
14 0.05
15 0.06
16 0.06
17 0.06
18 0.07
19 0.07
20 0.07
21 0.13
22 0.17
23 0.2
24 0.25
25 0.26
26 0.32
27 0.33
28 0.36
29 0.32
30 0.29
31 0.26
32 0.22
33 0.19
34 0.13
35 0.11
36 0.09
37 0.1
38 0.12
39 0.11
40 0.12
41 0.13
42 0.18
43 0.25
44 0.34
45 0.41
46 0.47
47 0.57
48 0.67
49 0.75
50 0.8
51 0.84
52 0.86
53 0.88
54 0.84
55 0.8
56 0.76
57 0.68
58 0.59
59 0.48
60 0.38
61 0.29
62 0.23
63 0.17
64 0.1
65 0.09
66 0.08
67 0.07
68 0.06
69 0.04
70 0.04
71 0.04
72 0.05
73 0.05
74 0.05
75 0.06
76 0.08
77 0.1
78 0.11
79 0.15
80 0.17
81 0.22
82 0.27
83 0.32
84 0.34
85 0.36
86 0.37
87 0.34
88 0.36
89 0.32
90 0.29
91 0.24
92 0.2
93 0.16
94 0.15
95 0.13
96 0.11
97 0.1
98 0.08
99 0.08
100 0.11
101 0.12
102 0.15
103 0.17
104 0.21
105 0.22
106 0.22
107 0.22
108 0.2
109 0.2
110 0.22
111 0.21
112 0.19
113 0.19
114 0.24
115 0.25
116 0.29
117 0.36
118 0.33
119 0.33
120 0.35
121 0.34
122 0.33
123 0.33
124 0.29
125 0.21
126 0.2
127 0.18
128 0.16
129 0.15
130 0.11
131 0.1
132 0.11
133 0.1
134 0.12
135 0.13
136 0.14
137 0.15
138 0.19
139 0.19
140 0.22
141 0.23
142 0.19
143 0.21
144 0.2
145 0.23
146 0.23
147 0.24
148 0.23